"NDC80" Related Products

Expand
Expand
Expand

Recombinant Human NDC80, His-tagged

Cat.No.: NDC80-27986TH
Product Overview: Recombinant fragment, corresponding to amino acids 350-642 of Human HEC1 with N terminal His tag; MWt 37 kDa.
Description: This gene encodes a component of the NDC80 kinetochore complex. The encoded protein consists of an N-terminal microtubule binding domain and a C-terminal coiled-coiled domain that interacts with other components of the complex. This protein functions to organize and stabilize microtubule-kinetochore interactions and is required for proper chromosome segregation.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 68 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: TRLQNIIDNQKYSVADIERINHERNELQQTINKLTKDLEA EQQKLWNEELKYARGKEAIETQLAEYHKLARKLKLIPK GAENSKGYDFEIKFNPEAGANCLVKYRAQVYVPLKELL NETEEEINKALNKKMGLEDTLEQLNAMITESKRSVRTL KEEVQKLDDLYQQKIKEAEEEDEKCASELESLEKHKHLLE STVNQGLSEAMNELDAVQREYQLVVQTTTEERRKVGNN LQRLLEMVATHVGSVEKHLEEQIAKVDREYEECMSEDL SENIKEIRDKYEKKATLIKSSEE
Sequence Similarities: Belongs to the NDC80/HEC1 family.
Gene Name: NDC80 NDC80 homolog, kinetochore complex component (S. cerevisiae) [ Homo sapiens ]
Official Symbol: NDC80
Synonyms: NDC80; NDC80 homolog, kinetochore complex component (S. cerevisiae); highly expressed in cancer, rich in leucine heptad repeats (yeast) , kinetochore associated 2 , KNTC2; kinetochore protein NDC80 homolog; HEC; HEC1; hsNDC80; TID3;
Gene ID: 10403
mRNA Refseq: NM_006101
Protein Refseq: NP_006092
MIM: 607272
Uniprot ID: O14777
Chromosome Location: 18p11.31
Pathway: Aurora B signaling, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; DNA Replication, organism-specific biosystem; M Phase, organism-specific biosystem; Mitotic M-M/G1 phases, organism-specific biosystem;
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.