Recombinant Human NDUFV1

Cat.No. : NDUFV1-29479TH
Product Overview : Recombinant fragment of Human NDUFV1 with N-terminal proprietary tag. Predicted MW 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The mitochondrial respiratory chain provides energy to cells via oxidative phosphorylation and consists of four membrane-bound electron-transporting protein complexes (I-IV) and an ATP synthase (complex V). This gene encodes a 51 kDa subunit of the NADH:ubiquinone oxidoreductase complex I; a large complex with at least 45 nuclear and mitochondrial encoded subunits that liberates electrons from NADH and channels them to ubiquinone. This subunit carries the NADH-binding site as well as flavin mononucleotide (FMN)- and Fe-S-biding sites. Defects in complex I are a common cause of mitochondrial dysfunction; a syndrome that occurs in approximately 1 in 10,000 live births. Mitochondrial complex I deficiency is linked to myopathies, encephalomyopathies, and neurodegenerative disorders such as Parkinsons disease and Leigh syndrome. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELEERMQRFAQQHQARQAAS
Sequence Similarities : Belongs to the complex I 51 kDa subunit family.
Gene Name NDUFV1 NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa [ Homo sapiens ]
Official Symbol NDUFV1
Synonyms NDUFV1; NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa; NADH dehydrogenase (ubiquinone) flavoprotein 1 (51kD); NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial; CI 51K; complex I 51kDa subunit; NADH dehydrogenase [ubiquinone] flavoprot
Gene ID 4723
mRNA Refseq NM_001166102
Protein Refseq NP_001159574
MIM 161015
Uniprot ID P49821
Chromosome Location 11q13
Pathway Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem;
Function 4 iron, 4 sulfur cluster binding; FMN binding; NAD binding; NADH dehydrogenase (ubiquinone) activity; NADH dehydrogenase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NDUFV1 Products

Required fields are marked with *

My Review for All NDUFV1 Products

Required fields are marked with *

0
cart-icon