Recombinant Human NDUFV1
Cat.No. : | NDUFV1-29479TH |
Product Overview : | Recombinant fragment of Human NDUFV1 with N-terminal proprietary tag. Predicted MW 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | The mitochondrial respiratory chain provides energy to cells via oxidative phosphorylation and consists of four membrane-bound electron-transporting protein complexes (I-IV) and an ATP synthase (complex V). This gene encodes a 51 kDa subunit of the NADH:ubiquinone oxidoreductase complex I; a large complex with at least 45 nuclear and mitochondrial encoded subunits that liberates electrons from NADH and channels them to ubiquinone. This subunit carries the NADH-binding site as well as flavin mononucleotide (FMN)- and Fe-S-biding sites. Defects in complex I are a common cause of mitochondrial dysfunction; a syndrome that occurs in approximately 1 in 10,000 live births. Mitochondrial complex I deficiency is linked to myopathies, encephalomyopathies, and neurodegenerative disorders such as Parkinsons disease and Leigh syndrome. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELEERMQRFAQQHQARQAAS |
Sequence Similarities : | Belongs to the complex I 51 kDa subunit family. |
Gene Name | NDUFV1 NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa [ Homo sapiens ] |
Official Symbol | NDUFV1 |
Synonyms | NDUFV1; NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa; NADH dehydrogenase (ubiquinone) flavoprotein 1 (51kD); NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial; CI 51K; complex I 51kDa subunit; NADH dehydrogenase [ubiquinone] flavoprot |
Gene ID | 4723 |
mRNA Refseq | NM_001166102 |
Protein Refseq | NP_001159574 |
MIM | 161015 |
Uniprot ID | P49821 |
Chromosome Location | 11q13 |
Pathway | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; |
Function | 4 iron, 4 sulfur cluster binding; FMN binding; NAD binding; NADH dehydrogenase (ubiquinone) activity; NADH dehydrogenase activity; |
◆ Recombinant Proteins | ||
NDUFV1-3224C | Recombinant Chicken NDUFV1 | +Inquiry |
NDUFV1-485C | Recombinant Cynomolgus Monkey NDUFV1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDUFV1-1086Z | Recombinant Zebrafish NDUFV1 | +Inquiry |
NDUFV1-10548M | Recombinant Mouse NDUFV1 Protein | +Inquiry |
NDUFV1-1243H | Recombinant Human NDUFV1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDUFV1-1180HCL | Recombinant Human NDUFV1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NDUFV1 Products
Required fields are marked with *
My Review for All NDUFV1 Products
Required fields are marked with *
0
Inquiry Basket