Recombinant Human NDUFV1
| Cat.No. : | NDUFV1-29479TH |
| Product Overview : | Recombinant fragment of Human NDUFV1 with N-terminal proprietary tag. Predicted MW 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | The mitochondrial respiratory chain provides energy to cells via oxidative phosphorylation and consists of four membrane-bound electron-transporting protein complexes (I-IV) and an ATP synthase (complex V). This gene encodes a 51 kDa subunit of the NADH:ubiquinone oxidoreductase complex I; a large complex with at least 45 nuclear and mitochondrial encoded subunits that liberates electrons from NADH and channels them to ubiquinone. This subunit carries the NADH-binding site as well as flavin mononucleotide (FMN)- and Fe-S-biding sites. Defects in complex I are a common cause of mitochondrial dysfunction; a syndrome that occurs in approximately 1 in 10,000 live births. Mitochondrial complex I deficiency is linked to myopathies, encephalomyopathies, and neurodegenerative disorders such as Parkinsons disease and Leigh syndrome. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | KAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELEERMQRFAQQHQARQAAS |
| Sequence Similarities : | Belongs to the complex I 51 kDa subunit family. |
| Gene Name | NDUFV1 NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa [ Homo sapiens ] |
| Official Symbol | NDUFV1 |
| Synonyms | NDUFV1; NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa; NADH dehydrogenase (ubiquinone) flavoprotein 1 (51kD); NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial; CI 51K; complex I 51kDa subunit; NADH dehydrogenase [ubiquinone] flavoprot |
| Gene ID | 4723 |
| mRNA Refseq | NM_001166102 |
| Protein Refseq | NP_001159574 |
| MIM | 161015 |
| Uniprot ID | P49821 |
| Chromosome Location | 11q13 |
| Pathway | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; |
| Function | 4 iron, 4 sulfur cluster binding; FMN binding; NAD binding; NADH dehydrogenase (ubiquinone) activity; NADH dehydrogenase activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDUFV1 Products
Required fields are marked with *
My Review for All NDUFV1 Products
Required fields are marked with *



