"NDUFV2" Related Products

Expand
Expand

Recombinant Human NDUFV2

Cat.No.: NDUFV2-29481TH
Product Overview: Recombinant full length Human NDUFV2 with a N terminal proprietary tag; Predicted MWt 53.46 kDa.
Description: The NADH-ubiquinone oxidoreductase complex (complex I) of the mitochondrial respiratory chain catalyzes the transfer of electrons from NADH to ubiquinone, and consists of at least 43 subunits. The complex is located in the inner mitochondrial membrane. This gene encodes the 24 kDa subunit of complex I, and is involved in electron transfer. Mutations in this gene are implicated in Parkinsons disease, bipolar disorder, schizophrenia, and have been found in one case of early onset hypertrophic cardiomyopathy and encephalopathy. A non-transcribed pseudogene of this locus is found on chromosome 19.
Protein length: 249 amino acids
Molecular Weight: 53.460kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MFFSAALRARAAGLTAHWGRHVRNLHKTAMQNGAGGALFV HRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVL PVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYT MYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKV GETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKD IEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKG PGFGVQAGL
Sequence Similarities: Belongs to the complex I 24 kDa subunit family.
Gene Name: NDUFV2 NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa [ Homo sapiens ]
Official Symbol: NDUFV2
Synonyms: NDUFV2; NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa; NADH dehydrogenase (ubiquinone) flavoprotein 2 (24kD); NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial; CI 24k; complex I 24kDa subunit; NADH dehydrogenase [ubiquinone] flavoprot
Gene ID: 4729
mRNA Refseq: NM_021074
Protein Refseq: NP_066552
MIM: 600532
Uniprot ID: P19404
Chromosome Location: 18p11.22
Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem;
Function: 2 iron, 2 sulfur cluster binding; NAD binding; NADH dehydrogenase (ubiquinone) activity; NADH dehydrogenase (ubiquinone) activity; NADH dehydrogenase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.