"NFIX" Related Products

Recombinant Human NFIX

Cat.No.: NFIX-30379TH
Product Overview: Recombinant fragment of Human NFIX with an N terminal proprietary tag; Predicted MW 36.63kDa.
Description: Nuclear factor 1 X-type is a protein that in humans is encoded by the NFIX gene.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: DDVFYPGTGRSPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGSSPRMAFTHHPLPVLAGVRPGSPRATASALHFPSTSIIQQSSPYFTHPTIR
Sequence Similarities: Belongs to the CTF/NF-I family.Contains 1 CTF/NF-I DNA-binding domain.
Gene Name: NFIX nuclear factor I/X (CCAAT-binding transcription factor) [ Homo sapiens ]
Official Symbol: NFIX
Synonyms: NFIX; nuclear factor I/X (CCAAT-binding transcription factor); nuclear factor 1 X-type; NF1A;
Gene ID: 4784
mRNA Refseq: NM_002501
Protein Refseq: NP_002492
MIM: 164005
Uniprot ID: Q14938
Chromosome Location: 19p13.3
Pathway: Oxidative Stress, organism-specific biosystem; RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription, organism-specific biosystem; RNA Polymerase III Abortive And Retractive Initiation, organism-specific biosystem; RNA Polymerase III Transcription, organism-specific biosystem; RNA Polymerase III Transcription Termination, organism-specific biosystem;
Function: DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity;
Products Types ◆ Recombinant Protein

◆ Lysates

Related Gene

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.