Recombinant Human NFKBIE, His-tagged

• Cat.No.: NFKBIE-28876TH
• Product Overview: Recombinant fragment, corresponding to amino acids 319-500 of Human IKB epsilon with N terminal His tag; 182 amino acids, 22kDa.

Specification

• Description: The protein encoded by this gene binds to components of NF-kappa-B, trapping the complex in the cytoplasm and preventing it from activating genes in the nucleus. Phosphorylation of the encoded protein targets it for destruction by the ubiquitin pathway, which activates NF-kappa-B by making it available to translocate to the nucleus.
• Conjugation: HIS
• Source: E. coli
• Tissue specificity: Highly expressed in spleen, testis and lung, followed by kidney, pancreas, heart, placenta and brain. Also expressed in granulocytes and macrophages.
• Form: Lyophilised:Reconstitute with 92 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SRALQDRHGDTALHVACQRQHLACARCLLEGRPEPGRGTS HSLDLQLQNWQGLACLHIATLQKNQPLMELLLRNGADI DVQEGTSGKTALHLAVETQERGLVQFLLQAGAQVDARMLN GCTPLHLAAGRGLMGISSTLCKAGADSLLRNVEDETPQ DLTEESLVLLPFDDLKISGKLLLCTD
• Sequence Similarities: Belongs to the NF-kappa-B inhibitor family.Contains 6 ANK repeats.

Gene Information

• Gene Name: NFKBIE nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon [ Homo sapiens ]
• Official Symbol: NFKBIE
• Synonyms: NFKBIE; nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon; NF-kappa-B inhibitor epsilon; IKBE
• Gene ID: 4794
• mRNA Refseq: NM_004556
• Protein Refseq: NP_004547
• MIM: 604548
• Uniprot ID: O00221
• Chromosome Location: 6p21.1
• Pathway: Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Apoptosis, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem