"NFYC" Related Products

Expand

Recombinant Human NFYC

Cat.No.: NFYC-29920TH
Product Overview: Recombinant fragment of Human NFYC with N-terminal proprietary tag. Predicted MW 36.63 kDa.
Description: This gene encodes one subunit of a trimeric complex forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoters of a variety of genes. The encoded protein, subunit C, forms a tight dimer with the B subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: DAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDF
Sequence Similarities: Belongs to the NFYC/HAP5 subunit family.
Gene Name: NFYC nuclear transcription factor Y, gamma [ Homo sapiens ]
Official Symbol: NFYC
Synonyms: NFYC; nuclear transcription factor Y, gamma; nuclear transcription factor Y subunit gamma; CBF C; NF YC;
Gene ID: 4802
mRNA Refseq: NM_001142587
Protein Refseq: NP_001136059
MIM: 605344
Uniprot ID: Q13952
Chromosome Location: 1p32
Pathway: Activation of Chaperones by ATF6-alpha, organism-specific biosystem; Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Diabetes pathways, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem;
Function: DNA binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.