Recombinant Human NIF3L1, His-tagged
Cat.No. : | NIF3L1-27231TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 101-350 of Human ALS2CR1 with N terminal His tag; Predicted MWt 28 kDa. |
- Specification
- Gene Information
- Related Products
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 93 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TAYDAAPQGVNNWLAKGLGACTSRPIHPSKAPNYPTEGNH RVEFNVNYTQDLDKVMSAVKGIDGVSVTSFSARTGNEE QTRINLNCTQKALMQVVDFLSRNKQLYQKTEILSLEKP LLLHTGMGRLCTLDESVSLATMIDRIKRHLKLSHIRLA LGVGRTLESQVKVVALCAGSGSSVLQGVEADLYLTGEMSH HDTLDAASQGINVILCEHSNTERGFLSDLRDMLDSHLE NKINIILSETDRDPLQVV |
Sequence Similarities : | Belongs to the UPF0135 (NIF3) family. |
Gene Name : | NIF3L1 NIF3 NGG1 interacting factor 3-like 1 (S. cerevisiae) [ Homo sapiens ] |
Official Symbol : | NIF3L1 |
Synonyms : | NIF3L1; NIF3 NGG1 interacting factor 3-like 1 (S. cerevisiae); ALS2CR1, NIF3 (Ngg1 interacting factor 3, S.pombe homolog) like 1 , NIF3 NGG1 interacting factor 3 like 1 (S. pombe); NIF3-like protein 1; CALS 7; MDS015; |
Gene ID : | 60491 |
mRNA Refseq : | NM_001136039 |
Protein Refseq : | NP_001129511 |
MIM : | 605778 |
Uniprot ID : | Q9GZT8 |
Chromosome Location : | 2q33 |
Function : | protein binding; transcription factor binding; |
Products Types
◆ Recombinant Protein | ||
NIF3L1-6064M | Recombinant Mouse NIF3L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NIF3L1-491C | Recombinant Cynomolgus Monkey NIF3L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NIF3L1-2847R | Recombinant Rhesus Macaque NIF3L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Nif3l1-4415M | Recombinant Mouse Nif3l1 Protein, Myc/DDK-tagged | +Inquiry |
NIF3L1-3195Z | Recombinant Zebrafish NIF3L1 | +Inquiry |
◆ Lysates | ||
NIF3L1-3828HCL | Recombinant Human NIF3L1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All NIF3L1 Products
Required fields are marked with *
My Review for All NIF3L1 Products
Required fields are marked with *
0
Inquiry Basket