Recombinant Human NR2F1

• Cat.No.: NR2F1-27964TH
• Product Overview: Recombinant fragment of Human COUP TF1 with proprietary tag, Predicted MWt 36.63kDa including tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: COUP-TF1 (COUP Transcription Factor 1) also known as NR2F1 (Nuclear Receptor subfamily 2, group F, member 1) is a protein that in humans is encoded by the NR2F1 gene.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: CRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFF
• Sequence Similarities: Belongs to the nuclear hormone receptor family. NR2 subfamily.Contains 1 nuclear receptor DNA-binding domain.

Gene Information

• Gene Name: NR2F1 nuclear receptor subfamily 2, group F, member 1 [ Homo sapiens ]
• Official Symbol: NR2F1
• Synonyms: NR2F1; nuclear receptor subfamily 2, group F, member 1; ERBAL3, TFCOUP1; COUP transcription factor 1; COUP TFI; EAR 3; SVP44; TCFCOUP1
• Gene ID: 7025
• mRNA Refseq: NM_005654
• Protein Refseq: NP_005645
• MIM: 132890
• Uniprot ID: P10589
• Chromosome Location: 5q14
• Pathway: Adipogenesis, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Nuclear Receptor transcription pathway, organism-specific biosystem; Nuclear Receptors, organism-specific biosystem
• Function: ligand-dependent nuclear receptor activity; ligand-regulated transcription factor activity; metal ion binding; protein binding; receptor activity