Recombinant Human NR2F1

Cat.No. : NR2F1-27964TH
Product Overview : Recombinant fragment of Human COUP TF1 with proprietary tag, Predicted MWt 36.63kDa including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : COUP-TF1 (COUP Transcription Factor 1) also known as NR2F1 (Nuclear Receptor subfamily 2, group F, member 1) is a protein that in humans is encoded by the NR2F1 gene.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : CRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFF
Sequence Similarities : Belongs to the nuclear hormone receptor family. NR2 subfamily.Contains 1 nuclear receptor DNA-binding domain.
Gene Name NR2F1 nuclear receptor subfamily 2, group F, member 1 [ Homo sapiens ]
Official Symbol NR2F1
Synonyms NR2F1; nuclear receptor subfamily 2, group F, member 1; ERBAL3, TFCOUP1; COUP transcription factor 1; COUP TFI; EAR 3; SVP44; TCFCOUP1;
Gene ID 7025
mRNA Refseq NM_005654
Protein Refseq NP_005645
MIM 132890
Uniprot ID P10589
Chromosome Location 5q14
Pathway Adipogenesis, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Nuclear Receptor transcription pathway, organism-specific biosystem; Nuclear Receptors, organism-specific biosystem;
Function ligand-dependent nuclear receptor activity; ligand-regulated transcription factor activity; metal ion binding; protein binding; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NR2F1 Products

Required fields are marked with *

My Review for All NR2F1 Products

Required fields are marked with *

0
cart-icon
0
compare icon