"NSMCE1" Related Products

Expand

Recombinant Human NSMCE1, His-tagged

Cat.No.: NSMCE1-29732TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-266 of Human NSMCE1 With N terminal His tag; 34 kDa.
Description: NSMCE1 is a probable component of the SMC5-SMC6 complex, a complex involved in DNA double strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double strand breaks.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 85 μl distilled water.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MQGSTRRMGVMTDVHRRFLQLLMTHGVLEEWDVKRLQTHC YKVHDRNATVDKLEDFINNINSVLESLYIEIKRGVTED DGRPIYALVNLATTSISKMATDFAENELDLFRKALELI IDSETGFASSTNILNLVDQLKGKKMRKKEAEQVLQKFV QNKWLIEKEGEFTLHGRAILEMEQYIRETYPDAVKICN ICHSLLIQGQSCETCGIRMHLPCVAKYFQSNAEPRCPHCNDYWPHEIPKVFDPEKERESGVLKSNKKSLRSRQH
Gene Name: NSMCE1 non-SMC element 1 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol: NSMCE1
Synonyms: NSMCE1; non-SMC element 1 homolog (S. cerevisiae); non-structural maintenance of chromosomes element 1 homolog; NSE1;
Gene ID: 197370
mRNA Refseq: NM_145080
Protein Refseq: NP_659547
Uniprot ID: Q8WV22
Chromosome Location: 16p12.1
Function: metal ion binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.