"OPA1" Related Products

Expand

Recombinant Human OPA1

Cat.No.: OPA1-30511TH
Product Overview: Recombinant fragment corresponding to amino acids 851-960 of Human OPA1 with an N terminal proprietary tag; Predicted MWt 37.73 kDa.
Description: This gene product is a nuclear-encoded mitochondrial protein with similarity to dynamin-related GTPases. It is a component of the mitochondrial network. Mutations in this gene have been associated with optic atrophy type 1, which is a dominantly inherited optic neuropathy resulting in progressive loss of visual acuity, leading in many cases to legal blindness. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein length: 110 amino acids
Molecular Weight: 37.730kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Highly expressed in retina. Also expressed in brain, testis, heart and skeletal muscle. Isoform 1 expressed in retina, skeletal muscle, heart, lung, ovary, colon, thyroid gland, leukocytes and fetal brain. Isoform 2 expressed in colon, liver, kidney, thyr
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: NHCNLCRRGFYYYQRHFVDSELECNDVVLFWRIQRMLAIT ANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEKKIKLLTG KRVQLAEDLKKVREIQEKLDAFIEALHQEK
Sequence Similarities: Belongs to the dynamin family.
Gene Name: OPA1 optic atrophy 1 (autosomal dominant) [ Homo sapiens ]
Official Symbol: OPA1
Synonyms: OPA1; optic atrophy 1 (autosomal dominant); dynamin-like 120 kDa protein, mitochondrial; FLJ12460; KIAA0567; MGM1; mitochondrial dynamin like GTPase; NPG; NTG;
Gene ID: 4976
mRNA Refseq: NM_015560
Protein Refseq: NP_056375
MIM: 605290
Uniprot ID: O60313
Chromosome Location: 3q28-q29
Function: GTP binding; GTPase activity; magnesium ion binding; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.