Recombinant Human ORC4

Cat.No. : ORC4-30514TH
Product Overview : Recombinant fragment of Human ORC4L with N terminal proprietary tag; Predicted MWt 53.39 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 248 amino acids
Description : The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. This gene encodes a subunit of the ORC complex. Several alternatively spliced transcript variants, some of which encode the same protein, have been reported for this gene.
Molecular Weight : 53.390kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGV QVQYKHLSELLKRTALHGESNSVLIIGPRGSGKTMLISHA LKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNL ENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDE FDLFAHHKNQTLLYNLFDISQSAQTPIAVIGLTCRLDILE LLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAEF PDKVFAEK
Sequence Similarities : Belongs to the ORC4 family.
Gene Name ORC4 origin recognition complex, subunit 4 [ Homo sapiens ]
Official Symbol ORC4
Synonyms ORC4; origin recognition complex, subunit 4; ORC4L, origin recognition complex, subunit 4 (yeast homolog) like , origin recognition complex, subunit 4 homolog (S. cerevisiae) , origin recognition complex, subunit 4 like (S. cerevisiae) , origin recogn
Gene ID 5000
mRNA Refseq NM_001190879
Protein Refseq NP_001177808
MIM 603056
Uniprot ID O43929
Chromosome Location 2q22-q23
Pathway Activation of ATR in response to replication stress, organism-specific biosystem; Activation of the pre-replicative complex, organism-specific biosystem; Assembly of the ORC complex at the origin of replication, organism-specific biosystem; Assembly of the pre-replicative complex, organism-specific biosystem; Association of licensing factors with the pre-replicative complex, organism-specific biosystem;
Function ATP binding; DNA binding; DNA replication origin binding; nucleoside-triphosphatase activity; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ORC4 Products

Required fields are marked with *

My Review for All ORC4 Products

Required fields are marked with *

0
cart-icon