Recombinant Human ORC4
Cat.No. : | ORC4-30514TH |
Product Overview : | Recombinant fragment of Human ORC4L with N terminal proprietary tag; Predicted MWt 53.39 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 248 amino acids |
Description : | The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. This gene encodes a subunit of the ORC complex. Several alternatively spliced transcript variants, some of which encode the same protein, have been reported for this gene. |
Molecular Weight : | 53.390kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGV QVQYKHLSELLKRTALHGESNSVLIIGPRGSGKTMLISHA LKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNL ENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDE FDLFAHHKNQTLLYNLFDISQSAQTPIAVIGLTCRLDILE LLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAEF PDKVFAEK |
Sequence Similarities : | Belongs to the ORC4 family. |
Gene Name | ORC4 origin recognition complex, subunit 4 [ Homo sapiens ] |
Official Symbol | ORC4 |
Synonyms | ORC4; origin recognition complex, subunit 4; ORC4L, origin recognition complex, subunit 4 (yeast homolog) like , origin recognition complex, subunit 4 homolog (S. cerevisiae) , origin recognition complex, subunit 4 like (S. cerevisiae) , origin recogn |
Gene ID | 5000 |
mRNA Refseq | NM_001190879 |
Protein Refseq | NP_001177808 |
MIM | 603056 |
Uniprot ID | O43929 |
Chromosome Location | 2q22-q23 |
Pathway | Activation of ATR in response to replication stress, organism-specific biosystem; Activation of the pre-replicative complex, organism-specific biosystem; Assembly of the ORC complex at the origin of replication, organism-specific biosystem; Assembly of the pre-replicative complex, organism-specific biosystem; Association of licensing factors with the pre-replicative complex, organism-specific biosystem; |
Function | ATP binding; DNA binding; DNA replication origin binding; nucleoside-triphosphatase activity; nucleotide binding; |
◆ Recombinant Proteins | ||
ORC4-1558H | Recombinant Human ORC4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ORC4-703H | Recombinant Human ORC4 Protein (1-436 aa), His-SUMO-tagged | +Inquiry |
ORC4-769C | Recombinant Cynomolgus ORC4 Protein, His-tagged | +Inquiry |
ORC4-513C | Recombinant Cynomolgus Monkey ORC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Orc4-4600M | Recombinant Mouse Orc4 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ORC4 Products
Required fields are marked with *
My Review for All ORC4 Products
Required fields are marked with *
0
Inquiry Basket