"OVOL1" Related Products

Expand
Expand

Recombinant Human OVOL1

Cat.No.: OVOL1-30527TH
Product Overview: Recombinant fragment of Human OVOL1 amino acids 2-100 with a N terminal proprietary tag; Predicted MWt 36.52 kDa including the tag.
Description: This gene encodes a putative zinc finger containing transcription factor that is highly similar to homologous protein in Drosophila and mouse. Based on known functions in these species, this protein is likely involved in hair formation and spermatogenesis in human as well.
Protein length: 99 amino acids
Molecular Weight: 36.520kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in fetal kidney, and also in adult pancreas and placenta. Not expressed in intestine, peripheral blood lymphocytes and ovary.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: PRAFLVKKPCVSTCKRNWSELPDEERGEIYVPVSLGFCPPQPYREPEPSVAEPPSCPLALNMSLRDSSYSMAPGPCVVAQLPSEDMGHLTDPQSRDHGF
Sequence Similarities: Contains 4 C2H2-type zinc fingers.
Gene Name: OVOL1 ovo-like 1(Drosophila) [ Homo sapiens ]
Official Symbol: OVOL1
Synonyms: OVOL1; ovo-like 1(Drosophila); ovo (Drosophila) homolog like 1; putative transcription factor Ovo-like 1;
Gene ID: 5017
mRNA Refseq: NM_004561
Protein Refseq: NP_004552
MIM: 602313
Uniprot ID: O14753
Chromosome Location: 11q13
Function: DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; metal ion binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.