Recombinant Human OVOL1
Cat.No. : | OVOL1-30527TH |
Product Overview : | Recombinant fragment of Human OVOL1 amino acids 2-100 with a N terminal proprietary tag; Predicted MWt 36.52 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 99 amino acids |
Description : | This gene encodes a putative zinc finger containing transcription factor that is highly similar to homologous protein in Drosophila and mouse. Based on known functions in these species, this protein is likely involved in hair formation and spermatogenesis in human as well. |
Molecular Weight : | 36.520kDa inclusive of tags |
Tissue specificity : | Expressed in fetal kidney, and also in adult pancreas and placenta. Not expressed in intestine, peripheral blood lymphocytes and ovary. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PRAFLVKKPCVSTCKRNWSELPDEERGEIYVPVSLGFCPPQPYREPEPSVAEPPSCPLALNMSLRDSSYSMAPGPCVVAQLPSEDMGHLTDPQSRDHGF |
Sequence Similarities : | Contains 4 C2H2-type zinc fingers. |
Gene Name | OVOL1 ovo-like 1(Drosophila) [ Homo sapiens ] |
Official Symbol | OVOL1 |
Synonyms | OVOL1; ovo-like 1(Drosophila); ovo (Drosophila) homolog like 1; putative transcription factor Ovo-like 1; |
Gene ID | 5017 |
mRNA Refseq | NM_004561 |
Protein Refseq | NP_004552 |
MIM | 602313 |
Uniprot ID | O14753 |
Chromosome Location | 11q13 |
Function | DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; metal ion binding; zinc ion binding; |
◆ Recombinant Proteins | ||
OVOL1-6444M | Recombinant Mouse OVOL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
OVOL1-6480Z | Recombinant Zebrafish OVOL1 | +Inquiry |
OVOL1-3264R | Recombinant Rhesus monkey OVOL1 Protein, His-tagged | +Inquiry |
OVOL1-30527TH | Recombinant Human OVOL1 | +Inquiry |
OVOL1-3082R | Recombinant Rhesus Macaque OVOL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OVOL1-1263HCL | Recombinant Human OVOL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OVOL1 Products
Required fields are marked with *
My Review for All OVOL1 Products
Required fields are marked with *