Recombinant Human PAM

• Cat.No.: PAM-30780TH
• Product Overview: Recombinant fragment of Human PAM with N terminal proprietary tag; Predicted MW 37.51kDa.

Specification

• Description: This gene encodes a multifunctional protein. It has two enzymatically active domains with catalytic activities - peptidylglycine alpha-hydroxylating monooxygenase (PHM) and peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL). These catalytic domains work sequentially to catalyze neuroendocrine peptides to active alpha-amidated products. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene but some of their full length sequences are not yet known.
• Protein length: 108 amino acids
• Molecular Weight: 37.510kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: FRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTR LPQPLIAGMYLMMSVDTVIPAGEKVVNSDISCHYKNYPMH VFAYRVHTHHLGKVVSGYRVRNGQWTLI
• Sequence Similarities: In the C-terminal section; belongs to the peptidyl-alpha-hydroxyglycine alpha-amidating lyase family.In the N-terminal section; belongs to the copper type II ascorbate-dependent monooxygenase family.Contains 5 NHL repeats.

Gene Information

• Gene Name: PAM peptidylglycine alpha-amidating monooxygenase [ Homo sapiens ]
• Official Symbol: PAM
• Synonyms: PAM; peptidylglycine alpha-amidating monooxygenase; peptidyl-glycine alpha-amidating monooxygenase; PAL; peptidyl alpha hydroxyglycine alpha amidating lyase; peptidylglycine alpha hydroxylating monooxygenase; PHM
• Gene ID: 5066
• mRNA Refseq: NM_000919
• Protein Refseq: NP_000910
• MIM: 170270
• Uniprot ID: P19021
• Chromosome Location: 5q
• Function: L-ascorbic acid binding; copper ion binding; lyase activity; metal ion binding; peptidylamidoglycolate lyase activity