Recombinant Human PAM
| Cat.No. : | PAM-30780TH |
| Product Overview : | Recombinant fragment of Human PAM with N terminal proprietary tag; Predicted MW 37.51kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 108 amino acids |
| Description : | This gene encodes a multifunctional protein. It has two enzymatically active domains with catalytic activities - peptidylglycine alpha-hydroxylating monooxygenase (PHM) and peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL). These catalytic domains work sequentially to catalyze neuroendocrine peptides to active alpha-amidated products. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene but some of their full length sequences are not yet known. |
| Molecular Weight : | 37.510kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | FRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTR LPQPLIAGMYLMMSVDTVIPAGEKVVNSDISCHYKNYPMH VFAYRVHTHHLGKVVSGYRVRNGQWTLI |
| Sequence Similarities : | In the C-terminal section; belongs to the peptidyl-alpha-hydroxyglycine alpha-amidating lyase family.In the N-terminal section; belongs to the copper type II ascorbate-dependent monooxygenase family.Contains 5 NHL repeats. |
| Gene Name | PAM peptidylglycine alpha-amidating monooxygenase [ Homo sapiens ] |
| Official Symbol | PAM |
| Synonyms | PAM; peptidylglycine alpha-amidating monooxygenase; peptidyl-glycine alpha-amidating monooxygenase; PAL; peptidyl alpha hydroxyglycine alpha amidating lyase; peptidylglycine alpha hydroxylating monooxygenase; PHM; |
| Gene ID | 5066 |
| mRNA Refseq | NM_000919 |
| Protein Refseq | NP_000910 |
| MIM | 170270 |
| Uniprot ID | P19021 |
| Chromosome Location | 5q |
| Function | L-ascorbic acid binding; copper ion binding; lyase activity; metal ion binding; peptidylamidoglycolate lyase activity; |
| ◆ Recombinant Proteins | ||
| PAM-30780TH | Recombinant Human PAM | +Inquiry |
| Pam-1170R | Recombinant Rat Pam Protein, His-tagged | +Inquiry |
| PAM-495H | Active Recombinant Human Peptidylglycine Alpha-Amidating Monooxygenase, His-tagged | +Inquiry |
| PAM-357HF | Recombinant Full Length Human PAM Protein | +Inquiry |
| PAM-559H | Recombinant Human PAM Protein, Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PAM-3448HCL | Recombinant Human PAM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PAM Products
Required fields are marked with *
My Review for All PAM Products
Required fields are marked with *



