Recombinant Human PAM
Cat.No. : | PAM-30780TH |
Product Overview : | Recombinant fragment of Human PAM with N terminal proprietary tag; Predicted MW 37.51kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 108 amino acids |
Description : | This gene encodes a multifunctional protein. It has two enzymatically active domains with catalytic activities - peptidylglycine alpha-hydroxylating monooxygenase (PHM) and peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL). These catalytic domains work sequentially to catalyze neuroendocrine peptides to active alpha-amidated products. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene but some of their full length sequences are not yet known. |
Molecular Weight : | 37.510kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | FRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTR LPQPLIAGMYLMMSVDTVIPAGEKVVNSDISCHYKNYPMH VFAYRVHTHHLGKVVSGYRVRNGQWTLI |
Sequence Similarities : | In the C-terminal section; belongs to the peptidyl-alpha-hydroxyglycine alpha-amidating lyase family.In the N-terminal section; belongs to the copper type II ascorbate-dependent monooxygenase family.Contains 5 NHL repeats. |
Gene Name | PAM peptidylglycine alpha-amidating monooxygenase [ Homo sapiens ] |
Official Symbol | PAM |
Synonyms | PAM; peptidylglycine alpha-amidating monooxygenase; peptidyl-glycine alpha-amidating monooxygenase; PAL; peptidyl alpha hydroxyglycine alpha amidating lyase; peptidylglycine alpha hydroxylating monooxygenase; PHM; |
Gene ID | 5066 |
mRNA Refseq | NM_000919 |
Protein Refseq | NP_000910 |
MIM | 170270 |
Uniprot ID | P19021 |
Chromosome Location | 5q |
Function | L-ascorbic acid binding; copper ion binding; lyase activity; metal ion binding; peptidylamidoglycolate lyase activity; |
◆ Recombinant Proteins | ||
PAM-495H | Active Recombinant Human Peptidylglycine Alpha-Amidating Monooxygenase, His-tagged | +Inquiry |
PAM-2542H | Recombinant Human PAM Protein, His-tagged | +Inquiry |
PAM-3926R | Recombinant Rat PAM Protein, His (Fc)-Avi-tagged | +Inquiry |
Pam-4666M | Recombinant Mouse Pam Protein, Myc/DDK-tagged | +Inquiry |
PAM-1519H | Recombinant Human PAM, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAM-3448HCL | Recombinant Human PAM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PAM Products
Required fields are marked with *
My Review for All PAM Products
Required fields are marked with *