"PANK4" Related Products

Expand

Recombinant Human PANK4, His-tagged

Cat.No.: PANK4-28661TH
Product Overview: Recombinant fragment, corresponding to amino acids 16-650 of Human PANK4 with an N terminal His tag. Predicted mwt: 72 kDa;
Description: This gene encodes a protein belonging to the pantothenate kinase family. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells. It catalyzes the first committed step in the universal biosynthetic pathway leading to CoA and is itself subject to regulation through feedback inhibition by CoA. This family member is most abundant in muscle but is expressed in all tissues.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 108 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: LDKSITLPPDEIFRNLENAKRFAIDIGGSLTKLAYYSTVQ HKVAKVRSFDHSGKDTEREHEPPYEISVQEEITARLHF IKFENTYIEACLDFIKDHLVNTETKVIQATGGGAYKFKDL IEEKLRLKVDKEDVMTCLIKGCNFVLKNIPHEAFVYQK DSDPEFRFQTNHPHIFPYLLVNIGSGVSIVKVETEDRF EWVGGSSIGGGTFWGLGALLTKTKKFDELLHLASRGQHSN VDMLVRDVYGGAHQTLGLSGNLIASSFGKSATADQEFS KEDMAKSLLHMISNDIGQLACLHARLHSLDRVYFGGFF IRGHPVTMRTITYSINFFSKGEVQALFLRHEGYLGAIGAF LKGAEQDNPNQYSWGENYAGSSGLMSASPELGPAQRAR SGTFDLLEMDRLERPLVDLPLLLDPPSYVPDTVDLTDD ALARKYWLTCFEEALDGVVKRAVASQPDSVDAAERAEKFR QKYWNKLQTLRQQPFAYGTLTVRSLLDTREHCLNEFNF PDPYSKVKQRENGVALRCFPGVVRSLDALGWEERQLAL VKGLLAGNVFDWGAKAVSAVLESDPYFGFEEAKRKLQERP WLVDSYSEWLQRLKGPPHKCALIFADNSGIDIILGVFP FVRELLLRGTEVILA
Gene Name: PANK4 pantothenate kinase 4 [ Homo sapiens ]
Official Symbol: PANK4
Synonyms: PANK4; pantothenate kinase 4; FLJ10782;
Gene ID: 55229
mRNA Refseq: NM_018216
Protein Refseq: NP_060686
MIM: 606162
Uniprot ID: Q9NVE7
Chromosome Location: 1p36.32
Pathway: Coenzyme A biosynthesis, organism-specific biosystem; Coenzyme A biosynthesis, pantothenate => CoA, organism-specific biosystem; Coenzyme A biosynthesis, pantothenate => CoA, conserved biosystem;
Function: ATP binding; nucleotide binding; pantothenate kinase activity; transferase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.