Recombinant Human PAWR

• Cat.No.: PAWR-28664TH
• Product Overview: Recombinant fragment of Human PAR4 with N-terminal proprietary tag.Mol Wt 37.73 kDa inclusive of tag.

Specification

• Description: The tumor suppressor WT1 represses and activates transcription. The protein encoded by this gene is a WT1-interacting protein that itself functions as a transcriptional repressor. It contains a putative leucine zipper domain which interacts with the zinc finger DNA binding domain of WT1. This protein is specifically upregulated during apoptosis of prostate cells.
• Protein length: 110 amino acids
• Molecular Weight: 37.730kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Widely expressed. Expression is elevated in various neurodegenerative diseases such as amyotrophic lateral sclerosis, Alzheimer, Parkinson and Huntington diseases and stroke. Down-regulated in several cancers.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEK KIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLL NRDLDDIEDENEQLKQENKTLLKVVGQLTR

Gene Information

• Gene Name: PAWR PRKC, apoptosis, WT1, regulator [ Homo sapiens ]
• Official Symbol: PAWR
• Synonyms: PAWR; PRKC, apoptosis, WT1, regulator; PRKC apoptosis WT1 regulator protein; par 4; PAR4
• Gene ID: 5074
• mRNA Refseq: NM_002583
• Protein Refseq: NP_002574
• MIM: 601936
• Uniprot ID: Q96IZ0
• Chromosome Location: 12q21.2
• Pathway: Ceramide signaling pathway, organism-specific biosystem; Coregulation of Androgen receptor activity, organism-specific biosystem; IL-4 signaling Pathway, organism-specific biosystem
• Function: actin binding; enzyme binding; leucine zipper domain binding; protein binding; transcription corepressor activity