Recombinant Human PAWR

Cat.No. : PAWR-28664TH
Product Overview : Recombinant fragment of Human PAR4 with N-terminal proprietary tag.Mol Wt 37.73 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : The tumor suppressor WT1 represses and activates transcription. The protein encoded by this gene is a WT1-interacting protein that itself functions as a transcriptional repressor. It contains a putative leucine zipper domain which interacts with the zinc finger DNA binding domain of WT1. This protein is specifically upregulated during apoptosis of prostate cells.
Molecular Weight : 37.730kDa inclusive of tags
Tissue specificity : Widely expressed. Expression is elevated in various neurodegenerative diseases such as amyotrophic lateral sclerosis, Alzheimer, Parkinson and Huntington diseases and stroke. Down-regulated in several cancers.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEK KIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLL NRDLDDIEDENEQLKQENKTLLKVVGQLTR
Gene Name PAWR PRKC, apoptosis, WT1, regulator [ Homo sapiens ]
Official Symbol PAWR
Synonyms PAWR; PRKC, apoptosis, WT1, regulator; PRKC apoptosis WT1 regulator protein; par 4; PAR4;
Gene ID 5074
mRNA Refseq NM_002583
Protein Refseq NP_002574
MIM 601936
Uniprot ID Q96IZ0
Chromosome Location 12q21.2
Pathway Ceramide signaling pathway, organism-specific biosystem; Coregulation of Androgen receptor activity, organism-specific biosystem; IL-4 signaling Pathway, organism-specific biosystem;
Function actin binding; enzyme binding; leucine zipper domain binding; protein binding; transcription corepressor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PAWR Products

Required fields are marked with *

My Review for All PAWR Products

Required fields are marked with *

0
cart-icon
0
compare icon