Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human PDE3A

Cat.No. : PDE3A-29931TH
Product Overview : Recombinant fragment of Human PDE3A with N-terminal proprietary tag.Mol Wt 37.51 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a member of the cGMP-inhibited cyclic nucleotide phosphodiesterase (cGI-PDE) family. cGI-PDE enzymes hydrolyze both cAMP and cGMP, and play critical roles in many cellular processes by regulating the amplitude and duration of intracellular cyclic nucleotide signals. The encoded protein mediates platelet aggregation and also plays important roles in cardiovascular function by regulating vascular smooth muscle contraction and relaxation. Inhibitors of the encoded protein may be effective in treating congestive heart failure. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Protein length : 108 amino acids
Molecular Weight : 37.510kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris buffered saline
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TPASSLVSKISAVQFPESADTTAKQSLGSHRALTYTQSAP DLSPQILTPPVICSSCGRPYSQGNPADEPLERSGVATRTP SRTDDTAQVTSDYETNNNSDSSDIVQNE
Sequence Similarities : Belongs to the cyclic nucleotide phosphodiesterase family. PDE3 subfamily.
Gene Name : PDE3A phosphodiesterase 3A, cGMP-inhibited [ Homo sapiens ]
Official Symbol : PDE3A
Synonyms : PDE3A; phosphodiesterase 3A, cGMP-inhibited; cGMP-inhibited 3,5-cyclic phosphodiesterase A; CGI PDE;
Gene ID : 5139
mRNA Refseq : NM_000921
Protein Refseq : NP_000912
MIM : 123805
Uniprot ID : Q14432
Chromosome Location : 12p12.2
Pathway : G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; Hemostasis, organism-specific biosystem; Insulin signaling pathway, organism-specific biosystem; Insulin signaling pathway, conserved biosystem;
Function : 3,5-cyclic-AMP phosphodiesterase activity; cAMP binding; cGMP-inhibited cyclic-nucleotide phosphodiesterase activity; hydrolase activity; metal ion binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends