"PDLIM2" Related Products

Expand

Recombinant Human PDLIM2, His-tagged

Cat.No.: PDLIM2-29566TH
Product Overview: Recombinant fragment, corresponding to amino acids 188-352 of Human PDLIM2 with N terminal His tag; 165 amino acids, 22kDa.
Description: This gene encodes a member of the ALP subfamily of PDZ-LIM domain proteins. The encoded protein suppresses anchorage-dependent growth and promotes cell migration and adhesion through interactions with the actin cytoskeleton via the PDZ domain. The encoded protein is also a putative tumor suppressor protein, and decreased expression of this gene is associated with several malignancies including breast cancer and adult T-cell leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 126 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: DSAVLVLPPSPGPRSSRPSMDSEGGSLLLDEDSEVFKMLQ ENREGRAAPRQSSSFRLLQEALEAEERGGTPAFLPSSL SPQSSLPASRALATPPKLHTCEKCSTSIANQAVRIQEGRYRHPGCYTCADCGLNLKMRGHFWVGDELYCEKHARQRYS APATLSSRA
Sequence Similarities: Contains 1 LIM zinc-binding domain.Contains 1 PDZ (DHR) domain.
Gene Name: PDLIM2 PDZ and LIM domain 2 (mystique) [ Homo sapiens ]
Official Symbol: PDLIM2
Synonyms: PDLIM2; PDZ and LIM domain 2 (mystique); PDZ and LIM domain protein 2;
Gene ID: 64236
mRNA Refseq: NM_021630
Protein Refseq: NP_067643
MIM: 609722
Uniprot ID: Q96JY6
Chromosome Location: 8p21.3
Function: metal ion binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.