Recombinant Human PDLIM2, His-tagged

Cat.No. : PDLIM2-29566TH
Product Overview : Recombinant fragment, corresponding to amino acids 188-352 of Human PDLIM2 with N terminal His tag; 165 amino acids, 22kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 188-352 a.a.
Description : This gene encodes a member of the ALP subfamily of PDZ-LIM domain proteins. The encoded protein suppresses anchorage-dependent growth and promotes cell migration and adhesion through interactions with the actin cytoskeleton via the PDZ domain. The encoded protein is also a putative tumor suppressor protein, and decreased expression of this gene is associated with several malignancies including breast cancer and adult T-cell leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 126 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DSAVLVLPPSPGPRSSRPSMDSEGGSLLLDEDSEVFKMLQ ENREGRAAPRQSSSFRLLQEALEAEERGGTPAFLPSSL SPQSSLPASRALATPPKLHTCEKCSTSIANQAVRIQEGRYRHPGCYTCADCGLNLKMRGHFWVGDELYCEKHARQRYS APATLSSRA
Sequence Similarities : Contains 1 LIM zinc-binding domain.Contains 1 PDZ (DHR) domain.
Gene Name PDLIM2 PDZ and LIM domain 2 (mystique) [ Homo sapiens ]
Official Symbol PDLIM2
Synonyms PDLIM2; PDZ and LIM domain 2 (mystique); PDZ and LIM domain protein 2;
Gene ID 64236
mRNA Refseq NM_021630
Protein Refseq NP_067643
MIM 609722
Uniprot ID Q96JY6
Chromosome Location 8p21.3
Function metal ion binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PDLIM2 Products

Required fields are marked with *

My Review for All PDLIM2 Products

Required fields are marked with *

0
cart-icon
0
compare icon