"PDYN" Related Products

Recombinant Human PDYN

Cat.No.: PDYN-31089TH
Product Overview: Recombinant fragment of Human ProDynorphin with N terminal proprietary tag; Predicted MWt 31.13 kDa including the tag.
Description: The protein encoded by this gene is a preproprotein that is proteolytically processed to form the secreted opioid peptides beta-neoendorphin, dynorphin, leu-enkephalin, rimorphin, and leumorphin. These peptides are ligands for the kappa-type of opioid receptor. Dynorphin is involved in modulating responses to several psychoactive substances, including cocaine. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.
Protein length: 50 amino acids
Molecular Weight: 31.130kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: KRYGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVTRSQEDPNAYSGELFDA
Sequence Similarities: Belongs to the opioid neuropeptide precursor family.
Gene Name: PDYN prodynorphin [ Homo sapiens ]
Official Symbol: PDYN
Synonyms: PDYN; prodynorphin; SCA23, spinocerebellar ataxia 23; proenkephalin-B; ADCA; beta neoendorphin; dynorphin; leu enkephalin; leumorphin; PENKB; preproenkephalin B; rimorphin;
Gene ID: 5173
mRNA Refseq: NM_001190892
Protein Refseq: NP_001177821
MIM: 131340
Uniprot ID: P01213
Chromosome Location: 20p13
Pathway: Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; G-protein activation, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem;
Function: opioid peptide activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.