Recombinant Human PER2
Cat.No. : | PER2-29936TH |
Product Overview : | Recombinant fragment of Human PER2 with a proprietary tag: predicted molecular weight 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. Circadian expression in the suprachiasmatic nucleus continues in constant darkness, and a shift in the light/dark cycle evokes a proportional shift of gene expression in the suprachiasmatic nucleus. The specific function of this gene is not yet known. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Widely expressed. Found in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. High levels in skeletal muscle and pancreas. Low level in lung. |
Biological activity : | Useful for Antibody Production and Protein Array |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MNGYAEFPPSPSNPTKEPVEPQPSQVPLQEDVDMSSGSSGHETNENCSTGRDSQGSDCDDSGKELGMLVEPPDARQSPDTFSLMMAKSEHNPSTSGCSSD |
Sequence Similarities : | Contains 1 PAC (PAS-associated C-terminal) domain.Contains 2 PAS (PER-ARNT-SIM) domains. |
Gene Name | PER2 period homolog 2 (Drosophila) [ Homo sapiens ] |
Official Symbol | PER2 |
Synonyms | PER2; period homolog 2 (Drosophila); period (Drosophila) homolog 2; period circadian protein homolog 2; KIAA0347; |
Gene ID | 8864 |
mRNA Refseq | NM_022817 |
Protein Refseq | NP_073728 |
MIM | 603426 |
Uniprot ID | O15055 |
Chromosome Location | 2q37.3 |
Pathway | BMAL1:CLOCK/NPAS2 Activates Gene Expression, organism-specific biosystem; Circadian Clock, organism-specific biosystem; Circadian rhythm - mammal, organism-specific biosystem; Circadian rhythm - mammal, conserved biosystem; Diurnally regulated genes with circadian orthologs, organism-specific biosystem; |
Function | protein binding transcription factor activity; signal transducer activity; |
◆ Recombinant Proteins | ||
PER2-5835C | Recombinant Chicken PER2 | +Inquiry |
PER2-4038R | Recombinant Rat PER2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PER2-12636M | Recombinant Mouse PER2 Protein | +Inquiry |
PER2-9646Z | Recombinant Zebrafish PER2 | +Inquiry |
PER2-29936TH | Recombinant Human PER2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PER2 Products
Required fields are marked with *
My Review for All PER2 Products
Required fields are marked with *
0
Inquiry Basket