Recombinant Human PER2

Cat.No. : PER2-29936TH
Product Overview : Recombinant fragment of Human PER2 with a proprietary tag: predicted molecular weight 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. Circadian expression in the suprachiasmatic nucleus continues in constant darkness, and a shift in the light/dark cycle evokes a proportional shift of gene expression in the suprachiasmatic nucleus. The specific function of this gene is not yet known.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Widely expressed. Found in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. High levels in skeletal muscle and pancreas. Low level in lung.
Biological activity : Useful for Antibody Production and Protein Array
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MNGYAEFPPSPSNPTKEPVEPQPSQVPLQEDVDMSSGSSGHETNENCSTGRDSQGSDCDDSGKELGMLVEPPDARQSPDTFSLMMAKSEHNPSTSGCSSD
Sequence Similarities : Contains 1 PAC (PAS-associated C-terminal) domain.Contains 2 PAS (PER-ARNT-SIM) domains.
Gene Name PER2 period homolog 2 (Drosophila) [ Homo sapiens ]
Official Symbol PER2
Synonyms PER2; period homolog 2 (Drosophila); period (Drosophila) homolog 2; period circadian protein homolog 2; KIAA0347;
Gene ID 8864
mRNA Refseq NM_022817
Protein Refseq NP_073728
MIM 603426
Uniprot ID O15055
Chromosome Location 2q37.3
Pathway BMAL1:CLOCK/NPAS2 Activates Gene Expression, organism-specific biosystem; Circadian Clock, organism-specific biosystem; Circadian rhythm - mammal, organism-specific biosystem; Circadian rhythm - mammal, conserved biosystem; Diurnally regulated genes with circadian orthologs, organism-specific biosystem;
Function protein binding transcription factor activity; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PER2 Products

Required fields are marked with *

My Review for All PER2 Products

Required fields are marked with *

0
cart-icon
0
compare icon