Recombinant Human PLN

• Cat.No.: PLN-30732TH
• Product Overview: Recombinant fragment corresponding to amino acids 1-30 of Human Phospholamban with an N terminal proprietary tag; Predicted MWt 28.93 kDa inclusive of tag.

Specification

• Description: The protein encoded by this gene is found as a pentamer and is a major substrate for the cAMP-dependent protein kinase in cardiac muscle. The encoded protein is an inhibitor of cardiac muscle sarcoplasmic reticulum Ca(2+)-ATPase in the unphosphorylated state, but inhibition is relieved upon phosphorylation of the protein. The subsequent activation of the Ca(2+) pump leads to enhanced muscle relaxation rates, thereby contributing to the inotropic response elicited in heart by beta-agonists. The encoded protein is a key regulator of cardiac diastolic function. Mutations in this gene are a cause of inherited human dilated cardiomyopathy with refractory congestive heart failure.
• Protein length: 30 amino acids
• Molecular Weight: 28.930kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Heart.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MEKVQYLTRSAIRRASTIEMPQQARQKLQN
• Sequence Similarities: Belongs to the phospholamban family.

Gene Information

• Gene Name: PLN phospholamban [ Homo sapiens ]
• Official Symbol: PLN
• Synonyms: PLN; phospholamban; PLB; cardiac phospholamban; CMD1P
• Gene ID: 5350
• mRNA Refseq: NM_002667
• Protein Refseq: NP_002658
• MIM: 172405
• Uniprot ID: P26678
• Chromosome Location: 6q22.1
• Pathway: Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem; Dilated cardiomyopathy, conserved biosystem
• Function: ATPase inhibitor activity; calcium channel regulator activity; protein binding