"PLN" Related Products

Expand
Expand

Recombinant Human PLN

Cat.No.: PLN-30732TH
Product Overview: Recombinant fragment corresponding to amino acids 1-30 of Human Phospholamban with an N terminal proprietary tag; Predicted MWt 28.93 kDa inclusive of tag.
Description: The protein encoded by this gene is found as a pentamer and is a major substrate for the cAMP-dependent protein kinase in cardiac muscle. The encoded protein is an inhibitor of cardiac muscle sarcoplasmic reticulum Ca(2+)-ATPase in the unphosphorylated state, but inhibition is relieved upon phosphorylation of the protein. The subsequent activation of the Ca(2+) pump leads to enhanced muscle relaxation rates, thereby contributing to the inotropic response elicited in heart by beta-agonists. The encoded protein is a key regulator of cardiac diastolic function. Mutations in this gene are a cause of inherited human dilated cardiomyopathy with refractory congestive heart failure.
Protein length: 30 amino acids
Molecular Weight: 28.930kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Heart.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MEKVQYLTRSAIRRASTIEMPQQARQKLQN
Sequence Similarities: Belongs to the phospholamban family.
Gene Name: PLN phospholamban [ Homo sapiens ]
Official Symbol: PLN
Synonyms: PLN; phospholamban; PLB; cardiac phospholamban; CMD1P;
Gene ID: 5350
mRNA Refseq: NM_002667
Protein Refseq: NP_002658
MIM: 172405
Uniprot ID: P26678
Chromosome Location: 6q22.1
Pathway: Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem; Dilated cardiomyopathy, conserved biosystem;
Function: ATPase inhibitor activity; calcium channel regulator activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.