Recombinant Human PLN Protein (1-52 aa), GST-tagged
Cat.No. : | PLN-1489H |
Product Overview : | Recombinant Human PLN Protein (1-52 aa) is produced by Yeast expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | GST |
Protein Length : | 1-52 aa |
Description : | Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca2+. Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN. ATP2A2 inhibition is alleviated by PLN phosphorylation |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 33.1 kDa |
AA Sequence : | MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | PLN phospholamban [ Homo sapiens ] |
Official Symbol | PLN |
Synonyms | PLN; phospholamban; PLB; CMD1P; CMH18; |
Gene ID | 5350 |
mRNA Refseq | NM_002667 |
Protein Refseq | NP_002658 |
MIM | 172405 |
UniProt ID | P26678 |
◆ Recombinant Proteins | ||
PLN-4936H | Recombinant Human PLN Protein (Met1-Leu52), N-GST tagged | +Inquiry |
PLN-1928H | Recombinant Human PLN protein, His & GST-tagged | +Inquiry |
PLN-4529R | Recombinant Rat PLN Protein | +Inquiry |
PLN-6961C | Recombinant Chicken PLN | +Inquiry |
PLN-6856M | Recombinant Mouse PLN Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLN Products
Required fields are marked with *
My Review for All PLN Products
Required fields are marked with *
0
Inquiry Basket