"PLXNB2" Related Products

Recombinant Human PLXNB2, His-tagged

Cat.No.: PLXNB2-30906TH
Product Overview: Recombinant fragment, corresponding to amino acids 1409-1838 of Human Plexin B2 with an N terminal His tag; Predicted MWt 50 kDa.
Description: Members of the B class of plexins, such as PLXNB2 are transmembrane receptors that participate in axon guidance and cell migration in response to semaphorins (Perrot et al.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 122 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: LYQYLKDSAGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTL NDTGLLGDDVEYAPLTVSVIVQDEGVDAIPVKVLNCDT ISQVKEKIIDQVYRGQPCSCWPRPDSVVLEWRPGSTAQ ILSDLDLTSQREGRWKRVNTLMHYNVRDGATLILSKVG VSQQPEDSQQDLPGERHALLEEENRVWHLVRPTDEVDEGK SKRGSVKEKERTKAITEIYLTRLLSVKGTLQQFVDNFF QSVLAPGHAVPPAVKYFFDFLDEQAEKHNIQDEDTIHI WKTNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIA QTFMDACTRTEHKLSRDSPSNKLLYAKEISTYKKMVED YYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQL YQYTQKYYDEIINALEEDPAAQKMQLAFRLQQIAAALE NKVTDL
Gene Name: PLXNB2 plexin B2 [ Homo sapiens ]
Official Symbol: PLXNB2
Synonyms: PLXNB2; plexin B2; plexin-B2; KIAA0315; MM1; PLEXB2;
Gene ID: 23654
mRNA Refseq: NM_012401
Protein Refseq: NP_036533
MIM: 604293
Uniprot ID: O15031
Chromosome Location: 22q13.33
Pathway: Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem;
Function: GTPase activator activity; protein binding; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.