"PNN" Related Products

Recombinant Human PNN

Cat.No.: PNN-30966TH
Product Overview: Recombinant fragment of Human Pinin with N-terminal proprietary tag.Mol Wt 36.63 kDa inclusive of tag.
Description: Transcriptional activator binding to the E-box 1 core sequence of the E-cadherin promoter gene; the core-binding sequence is 5CAGGTG-3. Capable of reversing CTBP1-mediated transcription repression.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in placenta, lung, liver, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, colon, heart, epidermis, esophagus, brain and smooth and skeletal muscle. Expressed strongly in melanoma metastasis lesions and advanced primar
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: AKQTELRLLEQKVELAQLQEEWNEHNAKIIKYIRTKTKPHLFYIPGRMCPATQKLIEESQRKMNALFEGRRIEFAEQINKMEARPRRQSMKEKEHQVVRN
Sequence Similarities: Belongs to the pinin family.
Gene Name: PNN pinin, desmosome associated protein [ Homo sapiens ]
Official Symbol: PNN
Synonyms: PNN; pinin, desmosome associated protein; pinin; memA;
Gene ID: 5411
mRNA Refseq: NM_002687
Protein Refseq: NP_002678
MIM: 603154
Uniprot ID: Q9H307
Chromosome Location: 14q21.1
Pathway: Exon junction complex (EJC), organism-specific biosystem; RNA transport, organism-specific biosystem; RNA transport, conserved biosystem; mRNA surveillance pathway, organism-specific biosystem; mRNA surveillance pathway, conserved biosystem;
Function: DNA binding; structural molecule activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.