"POFUT2" Related Products

Expand
Expand

Recombinant Human POFUT2, His-tagged

Cat.No.: POFUT2-27511TH
Product Overview: Recombinant fragment, corresponding to amino acids 196-429 of Human POFUT2 with N terminal His tag; Predicted MWt 28 kDa.
Description: Fucose is typically found as a terminal modification of branched chain glycoconjugates, but it also exists in direct O-linkage to serine or threonine residues within cystine knot motifs in epidermal growth factor (EGF; MIM 131530)-like repeats or thrombospondin (THBS; see MIM 188060) type-1 repeats. POFUT2 is an O-fucosyltransferase that use THBS type-1 repeats as substrates (Luo et al.
Conjugation: HIS
Source: E. coli
Tissue specificity: Isoform A is expressed in fetal liver and peripheral blood lymphocytes. Isoform B is expressed in spleen, lung, testis, bone marrow, thymus, pancreas, prostate, fetal brain, fetal liver and fetal kidney. Isoform C is expressed in brain, heart, spleen, liv
Form: Lyophilised:Reconstitute with 133 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: QGSASIVAPLLLRNTSARSVMLDRAENLLHDHYGGKEYWD TRRSMVFARHLREVGDEFRSRHLNSTDDADRIPFQEDW MKMKVKLGSALGGPYLGVHLRRKDFIWGHRQDVPSLEG AVRKIRSLMKTHRLDKVFVATDAVRKEYEELKKLLPEM VRFEPTWEELELYKDGGVAIIDQWICAHARFFIGTSVSTF SFRIHEEREILGLDPKTTYNRFCGDQEKACEQPTHWKI TY
Sequence Similarities: Belongs to the glycosyltransferase 68 family.
Gene Name: POFUT2 protein O-fucosyltransferase 2 [ Homo sapiens ]
Official Symbol: POFUT2
Synonyms: POFUT2; protein O-fucosyltransferase 2; C21orf80, chromosome 21 open reading frame 80; GDP-fucose protein O-fucosyltransferase 2; FUT13; KIAA0958;
Gene ID: 23275
mRNA Refseq: NM_015227
Protein Refseq: NP_056042
MIM: 610249
Uniprot ID: Q9Y2G5
Chromosome Location: 21q22.3
Pathway: Other types of O-glycan biosynthesis, organism-specific biosystem; Other types of O-glycan biosynthesis, conserved biosystem;
Function: peptide-O-fucosyltransferase activity; transferase activity, transferring glycosyl groups;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.