Recombinant Human POLG
Cat.No. : | POLG-28364TH |
Product Overview : | Recombinant fragment of Human DNA Polymerase gamma with an N terminal proprietary tag; predicted mwt: 37.73 inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | Mitochondrial DNA polymerase is heterotrimeric, consisting of a homodimer of accessory subunits plus a catalytic subunit. The protein encoded by this gene is the catalytic subunit of mitochondrial DNA polymerase. The encoded protein contains a polyglutamine tract near its N-terminus that may be polymorphic. Defects in this gene are a cause of progressive external ophthalmoplegia with mitochondrial DNA deletions 1 (PEOA1), sensory ataxic neuropathy dysarthria and ophthalmoparesis (SANDO), Alpers-Huttenlocher syndrome (AHS), and mitochondrial neurogastrointestinal encephalopathy syndrome (MNGIE). Two transcript variants encoding the same protein have been found for this gene. |
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | CISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAYKLG LNDLPQSVAFFSAVDIDRCLRKEVTMDCKTPSNPTGMERR YGIPQGEALDIYQIIELTKGSLEKRSQPGP |
Sequence Similarities : | Belongs to the DNA polymerase type-A family. |
Gene Name : | POLG polymerase (DNA directed), gamma [ Homo sapiens ] |
Official Symbol : | POLG |
Synonyms : | POLG; polymerase (DNA directed), gamma; DNA polymerase subunit gamma-1; POLG1; POLGA; |
Gene ID : | 5428 |
mRNA Refseq : | NM_001126131 |
Protein Refseq : | NP_001119603 |
MIM : | 174763 |
Uniprot ID : | P54098 |
Chromosome Location : | 15q24 |
Pathway : | DNA polymerase gamma complex, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Nucleotide Metabolism, organism-specific biosystem; |
Function : | DNA binding; DNA-directed DNA polymerase activity; chromatin binding; exonuclease activity; nucleotidyltransferase activity; |
Products Types
◆ Recombinant Protein | ||
POLG-317H | Recombinant Human POLG Protein, His-tagged | +Inquiry |
POLG-1529H | Recombinant Hepatitis C virus genotype 1b POLG Protein (S2420-R2989), His-tagged | +Inquiry |
POLG-1528H | Recombinant Hepatitis C virus genotype 1b POLG Protein (S2420-R2989) | +Inquiry |
POLG-4225R | Recombinant Rat POLG Protein, His (Fc)-Avi-tagged | +Inquiry |
POLG-632H | Recombinant Human POLG protein | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All POLG Products
Required fields are marked with *
My Review for All POLG Products
Required fields are marked with *
0
Inquiry Basket