"POLG" Related Products

Expand

Recombinant Human POLG

Cat.No.: POLG-28364TH
Product Overview: Recombinant fragment of Human DNA Polymerase gamma with an N terminal proprietary tag; predicted mwt: 37.73 inclusive of tag.
Description: Mitochondrial DNA polymerase is heterotrimeric, consisting of a homodimer of accessory subunits plus a catalytic subunit. The protein encoded by this gene is the catalytic subunit of mitochondrial DNA polymerase. The encoded protein contains a polyglutamine tract near its N-terminus that may be polymorphic. Defects in this gene are a cause of progressive external ophthalmoplegia with mitochondrial DNA deletions 1 (PEOA1), sensory ataxic neuropathy dysarthria and ophthalmoparesis (SANDO), Alpers-Huttenlocher syndrome (AHS), and mitochondrial neurogastrointestinal encephalopathy syndrome (MNGIE). Two transcript variants encoding the same protein have been found for this gene.
Protein length: 110 amino acids
Molecular Weight: 37.730kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: CISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAYKLG LNDLPQSVAFFSAVDIDRCLRKEVTMDCKTPSNPTGMERR YGIPQGEALDIYQIIELTKGSLEKRSQPGP
Sequence Similarities: Belongs to the DNA polymerase type-A family.
Gene Name: POLG polymerase (DNA directed), gamma [ Homo sapiens ]
Official Symbol: POLG
Synonyms: POLG; polymerase (DNA directed), gamma; DNA polymerase subunit gamma-1; POLG1; POLGA;
Gene ID: 5428
mRNA Refseq: NM_001126131
Protein Refseq: NP_001119603
MIM: 174763
Uniprot ID: P54098
Chromosome Location: 15q24
Pathway: DNA polymerase gamma complex, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Nucleotide Metabolism, organism-specific biosystem;
Function: DNA binding; DNA-directed DNA polymerase activity; chromatin binding; exonuclease activity; nucleotidyltransferase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.