Recombinant Human POU2AF1, His-tagged

• Cat.No.: POU2AF1-27491TH
• Product Overview: Recombinant full length Human BOB1 (1-256aa), with N-Terminal His-tag;29.6 kDa, 276aa inclusive of tag

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 256 amino acids
• Description: Transcriptional coactivator that specifically associates with either OCT1 or OCT2. It boosts the OCT1 mediated promoter activity and to a lesser extent, that of OCT2. It has no intrinsic DNA-binding activity.
• Conjugation: HIS
• Molecular Weight: 29.600kDa inclusive of tags
• Tissue specificity: B-cell specific.
• Form: Liquid
• Purity: by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDMEGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPSYTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHTLSVEGF
• Sequence Similarities: Belongs to the POU2AF1 family.

Gene Information

• Gene Name: POU2AF1 POU class 2 associating factor 1 [ Homo sapiens ]
• Official Symbol: POU2AF1
• Synonyms: POU2AF1; POU class 2 associating factor 1; POU domain class 2, associating factor 1; POU domain class 2-associating factor 1; OBF1
• Gene ID: 5450
• mRNA Refseq: NM_006235
• Protein Refseq: NP_006226
• MIM: 601206
• Uniprot ID: Q16633
• Chromosome Location: 11q23.1
• Function: DNA binding; transcription coactivator activity; transcription cofactor activity