"POU2AF1" Related Products

Recombinant Human POU2AF1, His-tagged

Cat.No.: POU2AF1-27491TH
Product Overview: Recombinant full length Human BOB1 (1-256aa), with N-Terminal His-tag;29.6 kDa, 276aa inclusive of tag
Description: Transcriptional coactivator that specifically associates with either OCT1 or OCT2. It boosts the OCT1 mediated promoter activity and to a lesser extent, that of OCT2. It has no intrinsic DNA-binding activity.
Protein length: 256 amino acids
Conjugation: HIS
Molecular Weight: 29.600kDa inclusive of tags
Source: E. coli
Tissue specificity: B-cell specific.
Form: Liquid
Purity: by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, pH 8.0
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDMEGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPSYTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHTLSVEGF
Sequence Similarities: Belongs to the POU2AF1 family.
Gene Name: POU2AF1 POU class 2 associating factor 1 [ Homo sapiens ]
Official Symbol: POU2AF1
Synonyms: POU2AF1; POU class 2 associating factor 1; POU domain class 2, associating factor 1; POU domain class 2-associating factor 1; OBF1;
Gene ID: 5450
mRNA Refseq: NM_006235
Protein Refseq: NP_006226
MIM: 601206
Uniprot ID: Q16633
Chromosome Location: 11q23.1
Function: DNA binding; transcription coactivator activity; transcription cofactor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.