Recombinant Human POU2AF1, His-tagged
Cat.No. : | POU2AF1-27491TH |
Product Overview : | Recombinant full length Human BOB1 (1-256aa), with N-Terminal His-tag;29.6 kDa, 276aa inclusive of tag |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 256 amino acids |
Description : | Transcriptional coactivator that specifically associates with either OCT1 or OCT2. It boosts the OCT1 mediated promoter activity and to a lesser extent, that of OCT2. It has no intrinsic DNA-binding activity. |
Conjugation : | HIS |
Molecular Weight : | 29.600kDa inclusive of tags |
Tissue specificity : | B-cell specific. |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDMEGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPSYTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHTLSVEGF |
Sequence Similarities : | Belongs to the POU2AF1 family. |
Gene Name | POU2AF1 POU class 2 associating factor 1 [ Homo sapiens ] |
Official Symbol | POU2AF1 |
Synonyms | POU2AF1; POU class 2 associating factor 1; POU domain class 2, associating factor 1; POU domain class 2-associating factor 1; OBF1; |
Gene ID | 5450 |
mRNA Refseq | NM_006235 |
Protein Refseq | NP_006226 |
MIM | 601206 |
Uniprot ID | Q16633 |
Chromosome Location | 11q23.1 |
Function | DNA binding; transcription coactivator activity; transcription cofactor activity; |
◆ Recombinant Proteins | ||
POU2AF1-5644H | Recombinant Human POU2AF1 protein, His-tagged | +Inquiry |
POU2AF1-3570H | Recombinant Human POU2AF1, His-tagged | +Inquiry |
POU2AF1-27491TH | Recombinant Human POU2AF1, His-tagged | +Inquiry |
POU2AF1-5749C | Recombinant Chicken POU2AF1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
POU2AF1-3004HCL | Recombinant Human POU2AF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POU2AF1 Products
Required fields are marked with *
My Review for All POU2AF1 Products
Required fields are marked with *