Recombinant Human POU2AF1 protein, His-tagged

Cat.No. : POU2AF1-5644H
Product Overview : Recombinant Human POU2AF1 protein(1-256 aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-256 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
AASequence : MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDMEGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPSYTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHTLSVEGF
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name POU2AF1 POU class 2 associating factor 1 [ Homo sapiens ]
Official Symbol POU2AF1
Synonyms POU2AF1; POU class 2 associating factor 1; POU domain class 2, associating factor 1; POU domain class 2-associating factor 1; OBF1; BOB-1; OCA-B; OCT-binding factor 1; B-cell-specific coactivator OBF-1; POU domain, class 2, associating factor 1; BOB1; OCAB; OBF-1;
Gene ID 5450
mRNA Refseq NM_006235
Protein Refseq NP_006226
MIM 601206
UniProt ID Q16633

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All POU2AF1 Products

Required fields are marked with *

My Review for All POU2AF1 Products

Required fields are marked with *

0
cart-icon
0
compare icon