Recombinant Human POU2AF1 protein, His-tagged

• Cat.No.: POU2AF1-5644H
• Product Overview: Recombinant Human POU2AF1 protein(1-256 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-256 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDMEGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPSYTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHTLSVEGF
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: POU2AF1 POU class 2 associating factor 1 [ Homo sapiens ]
• Official Symbol: POU2AF1
• Synonyms: POU2AF1; POU class 2 associating factor 1; POU domain class 2, associating factor 1; POU domain class 2-associating factor 1; OBF1; BOB-1; OCA-B; OCT-binding factor 1; B-cell-specific coactivator OBF-1; POU domain, class 2, associating factor 1; BOB1; OCAB; OBF-1
• Gene ID: 5450
• mRNA Refseq: NM_006235
• Protein Refseq: NP_006226
• MIM: 601206
• UniProt ID: Q16633