Recombinant Human PPP1R1B

Cat.No. : PPP1R1B-26806TH
Product Overview : Recombinant full length Human DARPP32 with proprietary tag; Predicted MWt 43.89 including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 168 amino acids
Description : This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 43.890kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT
Sequence Similarities : Belongs to the protein phosphatase inhibitor 1 family.
Gene Name PPP1R1B protein phosphatase 1, regulatory (inhibitor) subunit 1B [ Homo sapiens ]
Official Symbol PPP1R1B
Synonyms PPP1R1B; protein phosphatase 1, regulatory (inhibitor) subunit 1B; protein phosphatase 1 regulatory subunit 1B; DARPP 32; dopamine and cAMP regulated phosphoprotein; FLJ20940;
Gene ID 84152
mRNA Refseq NM_001242464
Protein Refseq NP_001229393
MIM 604399
Uniprot ID Q9UD71
Chromosome Location 17
Pathway DARPP-32 events, organism-specific biosystem; Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem; Nicotine Activity on Dopaminergic Neurons, organism-specific biosystem; Opioid Signalling, organism-specific biosystem;
Function cAMP-dependent protein kinase inhibitor activity; protein kinase inhibitor activity; protein phosphatase inhibitor activity; protein phosphatase type 1 regulator activity; receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPP1R1B Products

Required fields are marked with *

My Review for All PPP1R1B Products

Required fields are marked with *

0
cart-icon