"PPP1R1B" Related Products

Expand
Expand

Recombinant Human PPP1R1B

Cat.No.: PPP1R1B-26806TH
Product Overview: Recombinant full length Human DARPP32 with proprietary tag; Predicted MWt 43.89 including tag.
Description: This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein length: 168 amino acids
Molecular Weight: 43.890kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT
Sequence Similarities: Belongs to the protein phosphatase inhibitor 1 family.
Gene Name: PPP1R1B protein phosphatase 1, regulatory (inhibitor) subunit 1B [ Homo sapiens ]
Official Symbol: PPP1R1B
Synonyms: PPP1R1B; protein phosphatase 1, regulatory (inhibitor) subunit 1B; protein phosphatase 1 regulatory subunit 1B; DARPP 32; dopamine and cAMP regulated phosphoprotein; FLJ20940;
Gene ID: 84152
mRNA Refseq: NM_001242464
Protein Refseq: NP_001229393
MIM: 604399
Uniprot ID: Q9UD71
Chromosome Location: 17
Pathway: DARPP-32 events, organism-specific biosystem; Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem; Nicotine Activity on Dopaminergic Neurons, organism-specific biosystem; Opioid Signalling, organism-specific biosystem;
Function: cAMP-dependent protein kinase inhibitor activity; protein kinase inhibitor activity; protein phosphatase inhibitor activity; protein phosphatase type 1 regulator activity; receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.