"PPP1R8" Related Products

Recombinant Human PPP1R8

Cat.No.: PPP1R8-26964TH
Product Overview: Recombinant fragment of Human NIPP1, Isoform Gamma with N-terminal proprietary tag. Predicted MW 36.63kDa.
Description: This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Ubiquitously expressed, with highest levels in heart and skeletal muscle, followed by brain, placenta, lung, liver and pancreas. Less abundant in kidney. The concentration and ratio between isoforms is cell-type dependent. Isoform Alpha (>90%) and isoform
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: RRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI
Sequence Similarities: Contains 1 FHA domain.
Gene Name: PPP1R8 protein phosphatase 1, regulatory subunit 8 [ Homo sapiens ]
Official Symbol: PPP1R8
Synonyms: PPP1R8; protein phosphatase 1, regulatory subunit 8; protein phosphatase 1, regulatory (inhibitor) subunit 8; nuclear inhibitor of protein phosphatase 1; activator of RNA decay; ard 1; ARD1; NIPP 1; NIPP1; nuclear subunit of PP 1; PRO2047; protein phospha
Gene ID: 5511
mRNA Refseq: NM_002713
Protein Refseq: NP_002704
MIM: 602636
Uniprot ID: Q12972
Chromosome Location: 1p35.3
Function: DNA binding; RNA binding; endonuclease activity; hydrolase activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.