Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human PPP2R2C

Cat.No. : PPP2R2C-27932TH
Product Overview : Recombinant fragment of Human PPP2R2C with an N terminal proprietary tag; Predicted MW 37.73kDa.
  • Specification
  • Gene Information
  • Related Products
Description : The product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a gamma isoform of the regulatory subunit B55 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MGEDTDTRKINHSFLRDHSYVTEADIISTVEFNHTGELLA TGDKGGRVVIFQREPESKNAPHSQGEYDVYSTFQSHEPEF DYLKSLEIEEKINKIKWLPQQNAAHSLLST
Sequence Similarities : Belongs to the phosphatase 2A regulatory subunit B family.Contains 7 WD repeats.
Gene Name : PPP2R2C protein phosphatase 2, regulatory subunit B, gamma [ Homo sapiens ]
Official Symbol : PPP2R2C
Synonyms : PPP2R2C; protein phosphatase 2, regulatory subunit B, gamma; protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), gamma isoform , protein phosphatase 2 (formerly 2A), regulatory subunit B, gamma isoform; IMYPNO; MGC33570; PP2A subunit B iso
Gene ID : 5522
mRNA Refseq : NM_001206994
Protein Refseq : NP_001193923
MIM : 605997
Uniprot ID : Q9Y2T4
Chromosome Location : 4p16.1
Pathway : Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem; Glycogen Metabolism, organism-specific biosystem;
Function : protein phosphatase type 2A regulator activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All PPP2R2C Products

Required fields are marked with *

My Review for All PPP2R2C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends