"PRCP" Related Products

Expand
Expand
Expand

Recombinant Human PRCP

Cat.No.: PRCP-31107TH
Product Overview: Recombinant full length Human PRCP with N terminal proprietary tag; Predicted MW 80.63 kDa.
Description: The protein encoded by this gene is a lysosomal prolylcarboxypeptidase, which cleaves C-terminal amino acids linked to proline in peptides such as angiotension II, III and des-Arg9-bradykinin. The cleavage occurs at acidic pH, but the enzyme activity is retained with some substrates at neutral pH. This enzyme has been shown to be an activator of the cell matrix-associated prekallikrein. The importance of angiotension II, one of the substrates of this enzyme, in regulating blood pressure and electrolyte balance suggests that this gene may be related to essential hypertension. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
Protein length: 496 amino acids
Molecular Weight: 80.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Highest levels in placenta, lung and liver. Also present in heart, brain, pancreas and kidney.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MGRRALLLLLLSFLAPWATIALRPALRALGSLHLPTNPTS LPAVAKNYSVLYFQQKVDHFGFNTVKTFNQRYLVADKYWK KNGGSILFYTGNEGDIIWFCNNTGFMWDVAEELKAMLVFA EHRYYGESLPFGDNSFKDSRHLNFLTSEQALADFAELIKH LKRTIPGAENQPVIAIGGSYGGMLAAWFRMKYPHMVVGAL AASAPIWQFEDLVPCGVFMKIVTTDFRKSGPHCSESIHRS WDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWIS ETWVNLAMVDYPYASNFLQPLPAWPIKVVCQYLKNPNVSD SLLLQNIFQALNVYYNYSGQVKCLNISETATSSLGTLGWS YQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGV RPRPSWITTMYGGKNISSHTNIVFSNGELDPWSGGGVTKD ITDTLVAVTISEGAHHLDLRTKNALDPMSVLLARSLEVRH MKNWIRDFYDSAGKQH
Sequence Similarities: Belongs to the peptidase S28 family.
Gene Name: PRCP prolylcarboxypeptidase (angiotensinase C) [ Homo sapiens ]
Official Symbol: PRCP
Synonyms: PRCP; prolylcarboxypeptidase (angiotensinase C); lysosomal Pro-X carboxypeptidase; HUMPCP; PCP;
Gene ID: 5547
mRNA Refseq: NM_005040
Protein Refseq: NP_005031
MIM: 176785
Uniprot ID: P42785
Chromosome Location: 11q14
Pathway: Formation of Fibrin Clot (Clotting Cascade), organism-specific biosystem; Hemostasis, organism-specific biosystem; Intrinsic Pathway, organism-specific biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem;
Function: peptidase activity; protein binding; serine-type carboxypeptidase activity; serine-type peptidase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.