Recombinant Human PSG11
Cat.No. : | PSG11-27513TH |
Product Overview : | Recombinant full length Human Pregnancy specific beta 1 glycoprotein 11 with N terminal proprietary tag. Predicted MW 50.16 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The human pregnancy-specific glycoproteins (PSGs) are a group of molecules that are mainly produced by the placental syncytiotrophoblasts during pregnancy. PSGs comprise a subgroup of the carcinoembryonic antigen (CEA) family, which belongs to the immunoglobulin superfamily. For additional general information about the PSG gene family, see PSG1 (MIM 176390). |
Protein length : | 219 amino acids |
Molecular Weight : | 50.160kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MHAAEIMGPLSAPPCTEHIKWKGLLLTVETPKPSISSSNL NPREAMETVILTCNPETPDASYLWWMNGQSLPMTHRMQLS ETNRTLFLFGVTKYTAGPYECEIWNSGSASRSDPVTLNLL HGPDLPRIFPSVTSYYSGENLDLSCFADSNPPAQYSWTIN GKFQLSGQKLFIPQITPKHNGLYACSARNSATGEESSTSL TIRVIAPPGLGTFAFNNPT |
Sequence Similarities : | Belongs to the immunoglobulin superfamily. CEA family.Contains 2 Ig-like C2-type (immunoglobulin-like) domains.Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
Gene Name : | PSG11 pregnancy specific beta-1-glycoprotein 11 [ Homo sapiens ] |
Official Symbol : | PSG11 |
Synonyms : | PSG11; pregnancy specific beta-1-glycoprotein 11; PSG13, PSG14; pregnancy-specific beta-1-glycoprotein 11; MGC22484; pregnancy specific beta 1 glycoprotein 13; |
Gene ID : | 5680 |
mRNA Refseq : | NM_001113410 |
Protein Refseq : | NP_001106881 |
MIM : | 176401 |
Uniprot ID : | Q9UQ72 |
Chromosome Location : | 19q13.2 |
Products Types
◆ Recombinant Protein | ||
PSG11-2006H | Recombinant Human PSG11, GST-tagged | +Inquiry |
PSG11-218H | Recombinant Human PSG11 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
PSG11-2787HCL | Recombinant Human PSG11 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket