Recombinant Full Length Human PSG11 Protein

Cat.No. : PSG11-402HF
Product Overview : Recombinant full length Human Pregnancy specific beta 1 glycoprotein 11 with N terminal proprietary tag. Predicted MW 50.16 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 219 amino acids
Description : The human pregnancy-specific glycoproteins (PSGs) are a group of molecules that are mainly produced by the placental syncytiotrophoblasts during pregnancy. PSGs comprise a subgroup of the carcinoembryonic antigen (CEA) family, which belongs to the immunoglobulin superfamily. For additional general information about the PSG gene family, see PSG1 (MIM 176390).
Form : Liquid
Molecular Mass : 50.160kDa inclusive of tags
AA Sequence : MHAAEIMGPLSAPPCTEHIKWKGLLLTVETPKPSISSSNL NPREAMETVILTCNPETPDASYLWWMNGQSLPMTHRMQLS ETNRTLFLFGVTKYTAGPYECEIWNSGSASRSDPVTLNLL HGPDLPRIFPSVTSYYSGENLDLSCFADSNPPAQYSWTIN GKFQLSGQKLFIPQITPKHNGLYACSARNSATGEESSTSL TIRVIAPPGLGTFAFNNPT
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name PSG11 pregnancy specific beta-1-glycoprotein 11 [ Homo sapiens ]
Official Symbol PSG11
Synonyms PSG11; pregnancy specific beta-1-glycoprotein 11; PSG13, PSG14; pregnancy-specific beta-1-glycoprotein 11; MGC22484; pregnancy specific beta 1 glycoprotein 13
Gene ID 5680
mRNA Refseq NM_001113410
Protein Refseq NP_001106881
MIM 176401
UniProt ID Q9UQ72

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PSG11 Products

Required fields are marked with *

My Review for All PSG11 Products

Required fields are marked with *

0
cart-icon