Recombinant Full Length Human PSG11 Protein
Cat.No. : | PSG11-402HF |
Product Overview : | Recombinant full length Human Pregnancy specific beta 1 glycoprotein 11 with N terminal proprietary tag. Predicted MW 50.16 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 219 amino acids |
Description : | The human pregnancy-specific glycoproteins (PSGs) are a group of molecules that are mainly produced by the placental syncytiotrophoblasts during pregnancy. PSGs comprise a subgroup of the carcinoembryonic antigen (CEA) family, which belongs to the immunoglobulin superfamily. For additional general information about the PSG gene family, see PSG1 (MIM 176390). |
Form : | Liquid |
Molecular Mass : | 50.160kDa inclusive of tags |
AA Sequence : | MHAAEIMGPLSAPPCTEHIKWKGLLLTVETPKPSISSSNL NPREAMETVILTCNPETPDASYLWWMNGQSLPMTHRMQLS ETNRTLFLFGVTKYTAGPYECEIWNSGSASRSDPVTLNLL HGPDLPRIFPSVTSYYSGENLDLSCFADSNPPAQYSWTIN GKFQLSGQKLFIPQITPKHNGLYACSARNSATGEESSTSL TIRVIAPPGLGTFAFNNPT |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | PSG11 pregnancy specific beta-1-glycoprotein 11 [ Homo sapiens ] |
Official Symbol | PSG11 |
Synonyms | PSG11; pregnancy specific beta-1-glycoprotein 11; PSG13, PSG14; pregnancy-specific beta-1-glycoprotein 11; MGC22484; pregnancy specific beta 1 glycoprotein 13 |
Gene ID | 5680 |
mRNA Refseq | NM_001113410 |
Protein Refseq | NP_001106881 |
MIM | 176401 |
UniProt ID | Q9UQ72 |
◆ Recombinant Proteins | ||
PSG11-2006H | Recombinant Human PSG11, GST-tagged | +Inquiry |
PSG11-27513TH | Recombinant Human PSG11 | +Inquiry |
PSG11-402HF | Recombinant Full Length Human PSG11 Protein | +Inquiry |
PSG11-218H | Recombinant Human PSG11 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSG11-2787HCL | Recombinant Human PSG11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PSG11 Products
Required fields are marked with *
My Review for All PSG11 Products
Required fields are marked with *
0
Inquiry Basket