Recombinant Human PSG11
| Cat.No. : | PSG11-27513TH |
| Product Overview : | Recombinant full length Human Pregnancy specific beta 1 glycoprotein 11 with N terminal proprietary tag. Predicted MW 50.16 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 219 amino acids |
| Description : | The human pregnancy-specific glycoproteins (PSGs) are a group of molecules that are mainly produced by the placental syncytiotrophoblasts during pregnancy. PSGs comprise a subgroup of the carcinoembryonic antigen (CEA) family, which belongs to the immunoglobulin superfamily. For additional general information about the PSG gene family, see PSG1 (MIM 176390). |
| Molecular Weight : | 50.160kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MHAAEIMGPLSAPPCTEHIKWKGLLLTVETPKPSISSSNL NPREAMETVILTCNPETPDASYLWWMNGQSLPMTHRMQLS ETNRTLFLFGVTKYTAGPYECEIWNSGSASRSDPVTLNLL HGPDLPRIFPSVTSYYSGENLDLSCFADSNPPAQYSWTIN GKFQLSGQKLFIPQITPKHNGLYACSARNSATGEESSTSL TIRVIAPPGLGTFAFNNPT |
| Sequence Similarities : | Belongs to the immunoglobulin superfamily. CEA family.Contains 2 Ig-like C2-type (immunoglobulin-like) domains.Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
| Gene Name | PSG11 pregnancy specific beta-1-glycoprotein 11 [ Homo sapiens ] |
| Official Symbol | PSG11 |
| Synonyms | PSG11; pregnancy specific beta-1-glycoprotein 11; PSG13, PSG14; pregnancy-specific beta-1-glycoprotein 11; MGC22484; pregnancy specific beta 1 glycoprotein 13; |
| Gene ID | 5680 |
| mRNA Refseq | NM_001113410 |
| Protein Refseq | NP_001106881 |
| MIM | 176401 |
| Uniprot ID | Q9UQ72 |
| Chromosome Location | 19q13.2 |
| ◆ Recombinant Proteins | ||
| PSG11-218H | Recombinant Human PSG11 Protein, His-tagged | +Inquiry |
| PSG11-27513TH | Recombinant Human PSG11 | +Inquiry |
| PSG11-402HF | Recombinant Full Length Human PSG11 Protein | +Inquiry |
| PSG11-2006H | Recombinant Human PSG11, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PSG11-2787HCL | Recombinant Human PSG11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSG11 Products
Required fields are marked with *
My Review for All PSG11 Products
Required fields are marked with *




