Recombinant Human PSMB2, His-tagged

Cat.No. : PSMB2-31209TH
Product Overview : Recombinant full length, Human Proteasome subunit beta type 2 (amino acids 1-201) with an N terminal His tag, predicted Mwt: 24.9 kDa inclusive of tags.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 201 amino acids
Description : The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Conjugation : HIS
Molecular Weight : 24.900kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:30% Glycerol, 0.02% DTT, 0.32% Tris HCl, 0.58% Sodium chloride
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMEYLIGIQGPDYVLVASDRV AASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHV NLLLAGYDEHEGPALYYMDY LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELL RKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQG S
Sequence Similarities : Belongs to the peptidase T1B family.
Gene Name PSMB2 proteasome (prosome, macropain) subunit, beta type, 2 [ Homo sapiens ]
Official Symbol PSMB2
Synonyms PSMB2; proteasome (prosome, macropain) subunit, beta type, 2; proteasome subunit beta type-2; HC7 I;
Gene ID 5690
mRNA Refseq NM_001199779
Protein Refseq NP_001186708
MIM 602175
Uniprot ID P49721
Chromosome Location 1p34.2
Pathway APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem;
Function peptidase activity; threonine-type endopeptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PSMB2 Products

Required fields are marked with *

My Review for All PSMB2 Products

Required fields are marked with *

0
cart-icon
0
compare icon