"PSMB2" Related Products

Expand

Recombinant Human PSMB2, His-tagged

Cat.No.: PSMB2-31209TH
Product Overview: Recombinant full length, Human Proteasome subunit beta type 2 (amino acids 1-201) with an N terminal His tag, predicted Mwt: 24.9 kDa inclusive of tags.
Description: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Protein length: 201 amino acids
Conjugation: HIS
Molecular Weight: 24.900kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:30% Glycerol, 0.02% DTT, 0.32% Tris HCl, 0.58% Sodium chloride
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMEYLIGIQGPDYVLVASDRV AASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHV NLLLAGYDEHEGPALYYMDY LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELL RKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQG S
Sequence Similarities: Belongs to the peptidase T1B family.
Gene Name: PSMB2 proteasome (prosome, macropain) subunit, beta type, 2 [ Homo sapiens ]
Official Symbol: PSMB2
Synonyms: PSMB2; proteasome (prosome, macropain) subunit, beta type, 2; proteasome subunit beta type-2; HC7 I;
Gene ID: 5690
mRNA Refseq: NM_001199779
Protein Refseq: NP_001186708
MIM: 602175
Uniprot ID: P49721
Chromosome Location: 1p34.2
Pathway: APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem;
Function: peptidase activity; threonine-type endopeptidase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.