Recombinant Human PSMB2, His-tagged
Cat.No. : | PSMB2-31209TH |
Product Overview : | Recombinant full length, Human Proteasome subunit beta type 2 (amino acids 1-201) with an N terminal His tag, predicted Mwt: 24.9 kDa inclusive of tags. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 201 amino acids |
Description : | The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
Conjugation : | HIS |
Molecular Weight : | 24.900kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:30% Glycerol, 0.02% DTT, 0.32% Tris HCl, 0.58% Sodium chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMEYLIGIQGPDYVLVASDRV AASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHV NLLLAGYDEHEGPALYYMDY LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELL RKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQG S |
Sequence Similarities : | Belongs to the peptidase T1B family. |
Gene Name | PSMB2 proteasome (prosome, macropain) subunit, beta type, 2 [ Homo sapiens ] |
Official Symbol | PSMB2 |
Synonyms | PSMB2; proteasome (prosome, macropain) subunit, beta type, 2; proteasome subunit beta type-2; HC7 I; |
Gene ID | 5690 |
mRNA Refseq | NM_001199779 |
Protein Refseq | NP_001186708 |
MIM | 602175 |
Uniprot ID | P49721 |
Chromosome Location | 1p34.2 |
Pathway | APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; |
Function | peptidase activity; threonine-type endopeptidase activity; |
◆ Recombinant Proteins | ||
PSMB2-3656R | Recombinant Rhesus monkey PSMB2 Protein, His-tagged | +Inquiry |
PSMB2-3474R | Recombinant Rhesus Macaque PSMB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PSMB2-5083H | Recombinant Human PSMB2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PSMB2-1321H | Recombinant Human Proteasome (prosome, macropain) Subunit, Beta Type, 2, His-tagged | +Inquiry |
PSMB2-723Z | Recombinant Zebrafish PSMB2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMB2-2774HCL | Recombinant Human PSMB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSMB2 Products
Required fields are marked with *
My Review for All PSMB2 Products
Required fields are marked with *