"PURG" Related Products

Recombinant Human PURG

Cat.No.: PURG-31267TH
Product Overview: Recombinant full length Human PURG expressed in Saccharomyces cerevisiae; 347 amino acids, MWt 39.5 kDa. Protein is tagged with 26 kDa proprietary tag.
Description: The exact function of this gene is not known, however, its encoded product is highly similar to purine-rich element binding protein A. The latter is a DNA-binding protein which binds preferentially to the single strand of the purine-rich element termed PUR, and has been implicated in the control of both DNA replication and transcription. This gene lies in close proximity to the Werner syndrome gene, but on the opposite strand, on chromosome 8p11. Two transcript variants encoding different isoforms have been found for this gene.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage: Shipped at 4°C. Store at -20oC.
Sequences of amino acids: MERARRRGGGGGRGRGGKNVGGSGLSKSRLYPQAQHSHYP HYAASATPNQAGGAAEIQELASKRVDIQKKRFYLDVKQ SSRGRFLKIAEVWIGRGRQDNIRKSKLTLSLSVAAELK DCLGDFIEHYAHLGLKGHRQEHGHSKEQGSRRRQKHSAPS PPVSVGSEEHPHSVLKTDYIERDNRKYYLDLKENQRGR FLRIRQTMMRGTGMIGYFGHSLGQEQTIVLPAQGMIEF RDALVQLIEDYGEGDIEERRGGDDDPLELPEGTSFRVDNKRFYFDVGSNKYGIFLKVSEVRPPYRNTITVPFKAWTRF GENFIKYEEEMRKICNSHKEKRMDGRKASGEEQECLD
Gene Name: PURG purine-rich element binding protein G [ Homo sapiens ]
Official Symbol: PURG
Synonyms: PURG; purine-rich element binding protein G; purine-rich element-binding protein gamma; PURG A; PURG B;
Gene ID: 29942
mRNA Refseq: NM_013357
Protein Refseq: NP_037489
Uniprot ID: Q9UJV8
Chromosome Location: 8p11
Function: DNA binding;
Products Types ◆ Recombinant Protein

◆ Lysates

Related Gene

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.