"PYY" Related Products

Expand
Expand

Recombinant Human PYY

Cat.No.: PYY-29935TH
Product Overview: Recombinant full length Human Peptide YY with N terminal proprietary tag; Predicted MWt 36.74 kDa.
Description: The protein encoded by this gene is proteolytically processed to release a peptide that inhibits pancreatic secretion and mobility in the gut. Rare variations in this gene could increase susceptibility to obesity.
Protein length: 97 amino acids
Molecular Weight: 36.740kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW
Sequence Similarities: Belongs to the NPY family.
Gene Name: PYY peptide YY [ Homo sapiens ]
Official Symbol: PYY
Synonyms: PYY; peptide YY; PYY1;
Gene ID: 5697
mRNA Refseq: NM_004160
Protein Refseq: NP_004151
Uniprot ID: P10082
Chromosome Location: 17q21.1
Pathway: Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Peptide ligand-binding receptors, organism-specific biosystem;
Function: hormone activity; neuropeptide hormone activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.