Recombinant Human RAB2B, His-tagged
Cat.No. : | RAB2B-30602TH |
Product Overview : | Recombinant full length Human RAB2B with N terminal His tag; 240 amino acids with tag, Predicted MWt 26.8 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Members of the Rab protein family are nontransforming monomeric GTP-binding proteins of the Ras superfamily that contain 4 highly conserved regions involved in GTP binding and hydrolysis. Rab proteins are prenylated, membrane-bound proteins involved in vesicular fusion and trafficking; see MIM 179508. |
Protein length : | 216 amino acids |
Conjugation : | HIS |
Molecular Weight : | 26.800kDa inclusive of tags |
Source : | E. coli |
Tissue specificity : | Expressed in kidney, prostate, lung, liver, thymus, colon, pancreas, and skeletal muscle, and low levels in placenta. Not detected in heart, brain, spleen, testis, ovary, small intestine and leukocyte. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.88% Sodium chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMTYAYLFKYIIIGDTG VGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIK LQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNH LTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVKREEGEA FAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGLF DVHNEANGIKIGPQQSISTSVGPSASQRNSRDIGSNSGCC |
Sequence Similarities : | Belongs to the small GTPase superfamily. Rab family. |
Gene Name : | RAB2B RAB2B, member RAS oncogene family [ Homo sapiens ] |
Official Symbol : | RAB2B |
Synonyms : | RAB2B; RAB2B, member RAS oncogene family; ras-related protein Rab-2B; FLJ14824; |
Gene ID : | 84932 |
mRNA Refseq : | NM_001163380 |
Protein Refseq : | NP_001156852 |
MIM : | 607466 |
Uniprot ID : | Q8WUD1 |
Chromosome Location : | 14q11.1 |
Function : | GTP binding; nucleotide binding; |
Products Types
◆ Recombinant Protein | ||
RAB2B-7349M | Recombinant Mouse RAB2B Protein, His (Fc)-Avi-tagged | +Inquiry |
Rab2b-5306M | Recombinant Mouse Rab2b Protein, Myc/DDK-tagged | +Inquiry |
RAB2B-13806M | Recombinant Mouse RAB2B Protein | +Inquiry |
RAB2B-4828H | Recombinant Human RAB2B, Member RAS Oncogene Family, His-tagged | +Inquiry |
RAB2B-2112H | Recombinant Human RAB2B, GST-tagged | +Inquiry |
◆ Lysates | ||
RAB2B-2610HCL | Recombinant Human RAB2B 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket