"RAG2" Related Products

Expand

Recombinant Human RAG2

Cat.No.: RAG2-29371TH
Product Overview: Recombinant full length Human RAG2 with N terminal proprietary tag; Predicted MWt 84.04 kDa inclusive of tag.
Description: This gene encodes a protein that is involved in the initiation of V(D)J recombination during B and T cell development. This protein forms a complex with the product of the adjacent recombination activating gene 1, and this complex can form double-strand breaks by cleaving DNA at conserved recombination signal sequences. The recombination activating gene 1 component is thought to contain most of the catalytic activity, while the N-terminal of the recombination activating gene 2 component is thought to form a six-bladed propeller in the active core that serves as a binding scaffold for the tight association of the complex with DNA. A C-terminal plant homeodomain finger-like motif in this protein is necessary for interactions with chromatin components, specifically with histone H3 that is trimethylated at lysine 4. Mutations in this gene cause Omenn syndrome, a form of severe combined immunodeficiency associated with autoimmune-like symptoms.
Protein length: 527 amino acids
Molecular Weight: 84.040kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Cells of the B- and T-lymphocyte lineages.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MSLQMVTVSNNIALIQPGFSLMNFDGQVFFFGQKGWPKRS CPTGVFHLDVKHNHVKLKPTIFSKDSCYLPPLRYPATCTF KGSLESEKHQYIIHGGKTPNNEVSDKIYVMSIVCKNNKKV TFRCTEKDLVGDVPEARYGHSINVVYSRGKSMGALFGGRS YMPSTHRTTEKWNSVADCLPCVFLVDFEFGCATSYILPEL QDGLSFHVSIAKNDTIYILGGHSLANNIRPANLYRIRVDL PLGSPAVNCTVLPGGISVSSAILTQTNNDEFVIVGGYQLE NQKRMICNIISLEDNKIEIREMETPDWTPDIKHSKIWFGS NTGNGTVFLGIPGDNKQVVSEGFYFYMLKCAEDDTNEEQT TFTNSQTSTEDPGDSTPFEDSEEFCFSAEANSFDGDDEFD TYNEDDEEDESETGYWITCCPTCDVDINTWVPFYSTELNK PAMIYCSHGDGHWVHAQCMDLAERTLIHLSAGSNKYYCNE HVEIARALHTPQRVLPLKKPPMKSLRKKGSGKILTPAKKS FLRRLFD
Sequence Similarities: Belongs to the RAG2 family.Contains 1 PHD-type zinc finger.
Gene Name: RAG2 recombination activating gene 2 [ Homo sapiens ]
Official Symbol: RAG2
Synonyms: RAG2; recombination activating gene 2; V(D)J recombination-activating protein 2;
Gene ID: 5897
mRNA Refseq: NM_000536
Protein Refseq: NP_000527
MIM: 179616
Uniprot ID: P55895
Chromosome Location: 11p13
Pathway: C-MYB transcription factor network, organism-specific biosystem; Primary immunodeficiency, organism-specific biosystem; Primary immunodeficiency, conserved biosystem;
Function: DNA binding; chromatin binding; endonuclease activity; metal ion binding; methylated histone residue binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.