Recombinant Human RAG2 RAG2-29371TH

Recombinant Human RAG2

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human RAG2

Recombinant Human RAG2

RAG2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : RAG2-29371TH
Product Overview : Recombinant full length Human RAG2 with N terminal proprietary tag; Predicted MWt 84.04 kDa inclusive of tag.
Description : This gene encodes a protein that is involved in the initiation of V(D)J recombination during B and T cell development. This protein forms a complex with the product of the adjacent recombination activating gene 1, and this complex can form double-strand breaks by cleaving DNA at conserved recombination signal sequences. The recombination activating gene 1 component is thought to contain most of the catalytic activity, while the N-terminal of the recombination activating gene 2 component is thought to form a six-bladed propeller in the active core that serves as a binding scaffold for the tight association of the complex with DNA. A C-terminal plant homeodomain finger-like motif in this protein is necessary for interactions with chromatin components, specifically with histone H3 that is trimethylated at lysine 4. Mutations in this gene cause Omenn syndrome, a form of severe combined immunodeficiency associated with autoimmune-like symptoms.
Protein length : 527 amino acids
Molecular Weight : 84.040kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Cells of the B- and T-lymphocyte lineages.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MSLQMVTVSNNIALIQPGFSLMNFDGQVFFFGQKGWPKRS CPTGVFHLDVKHNHVKLKPTIFSKDSCYLPPLRYPATCTF KGSLESEKHQYIIHGGKTPNNEVSDKIYVMSIVCKNNKKV TFRCTEKDLVGDVPEARYGHSINVVYSRGKSMGALFGGRS YMPSTHRTTEKWNSVADCLPCVFLVDFEFGCATSYILPEL QDGLSFHVSIAKNDTIYILGGHSLANNIRPANLYRIRVDL PLGSPAVNCTVLPGGISVSSAILTQTNNDEFVIVGGYQLE NQKRMICNIISLEDNKIEIREMETPDWTPDIKHSKIWFGS NTGNGTVFLGIPGDNKQVVSEGFYFYMLKCAEDDTNEEQT TFTNSQTSTEDPGDSTPFEDSEEFCFSAEANSFDGDDEFD TYNEDDEEDESETGYWITCCPTCDVDINTWVPFYSTELNK PAMIYCSHGDGHWVHAQCMDLAERTLIHLSAGSNKYYCNE HVEIARALHTPQRVLPLKKPPMKSLRKKGSGKILTPAKKS FLRRLFD
Sequence Similarities : Belongs to the RAG2 family.Contains 1 PHD-type zinc finger.
Gene Name : RAG2 recombination activating gene 2 [ Homo sapiens ]
Official Symbol : RAG2
Synonyms : RAG2; recombination activating gene 2; V(D)J recombination-activating protein 2;
Gene ID : 5897
mRNA Refseq : NM_000536
Protein Refseq : NP_000527
MIM : 179616
Uniprot ID : P55895
Chromosome Location : 11p13
Pathway : C-MYB transcription factor network, organism-specific biosystem; Primary immunodeficiency, organism-specific biosystem; Primary immunodeficiency, conserved biosystem;
Function : DNA binding; chromatin binding; endonuclease activity; metal ion binding; methylated histone residue binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy