"RANGAP1" Related Products

Expand
Expand

Recombinant Human RANGAP1, His-tagged

Cat.No.: RANGAP1-30474TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-357 of Human RanGAP1 with N terminal His tag. MWt 41kDa;
Description: RanGAP1, is a homodimeric 65-kD polypeptide that specifically induces the GTPase activity of RAN, but not of RAS by over 1,000-fold. RanGAP1 is the immediate antagonist of RCC1, a regulator molecule that keeps RAN in the active, GTP-bound state. The RANGAP1 gene encodes a 587-amino acid polypeptide. The sequence is unrelated to that of GTPase activators for other RAS-related proteins, but is 88% identical to Fug1, the murine homolog of yeast Rna1p. RanGAP1 and RCC1 control RAN-dependent transport between the nucleus and cytoplasm. RanGAP1 is a key regulator of the RAN GTP/GDP cycle.
Conjugation: HIS
Source: E. coli
Tissue specificity: Highly expressed in brain, thymus and testis.
Form: Lyophilised:Reconstitution with 98 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKD VIKEIEDFDSLEALRLEGNTVGVEAARVIAKALEKKSE LKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVE LDLSDNAFGPDGVQGFEALLKSSACFTLQELKLNNCGMGI GGGKILAAALTECHRKSSAQGKPLALKVFVAGRNRLEN DGATALAEAFRVIGTLEEVHMPQNGINHPGITALAQAF AVNPLLRVINLNDNTFTEKGAVAMAETLKTLRQVEVINFG DCLVRSKGAVAIADAIRGGLPKLKELNLSFCEIKRDAA LAVAEAMADKAELEKLDLNGNTLGEEGCEQLQEVLEGF NMAKVLASL
Sequence Similarities: Belongs to the RNA1 family.Contains 6 LRR (leucine-rich) repeats.
Gene Name: RANGAP1 Ran GTPase activating protein 1 [ Homo sapiens ]
Official Symbol: RANGAP1
Synonyms: RANGAP1; Ran GTPase activating protein 1; SD, segregation distorter homolog (Drosophila); ran GTPase-activating protein 1; Fug1; KIAA1835;
Gene ID: 5905
mRNA Refseq: NM_002883
Protein Refseq: NP_002874
MIM: 602362
Uniprot ID: P46060
Chromosome Location: 22q13
Pathway: Cell Cycle, Mitotic, organism-specific biosystem; DNA Replication, organism-specific biosystem; HIV Infection, organism-specific biosystem; HIV Life Cycle, organism-specific biosystem; Host Interactions of HIV factors, organism-specific biosystem;
Function: GTPase activator activity; Ran GTPase activator activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.