"RAP2A" Related Products

Expand

Recombinant Human RAP2A, His-tagged

Cat.No.: RAP2A-30504TH
Product Overview: Recombinant full length Human Rap2A with an N terminal His tag; 200 amino acids with tag, Predicted MWt 22.4 kDa.
Description: Ribokinase, also known as RBKS, belongs to the pfkB family of carbohydrate kinases. It phosphorylates ribose to form ribose-5-phosphate in the presence of ATP and magnesium as a first step in ribose metabolism.
Protein length: 180 amino acids
Conjugation: HIS
Molecular Weight: 22.400kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGCPFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSAC
Gene Name: RAP2A RAP2A, member of RAS oncogene family [ Homo sapiens ]
Official Symbol: RAP2A
Synonyms: RAP2A; RAP2A, member of RAS oncogene family; RAP2; ras-related protein Rap-2a; K REV;
Gene ID: 5911
mRNA Refseq: NM_021033
Protein Refseq: NP_066361
MIM: 179540
Uniprot ID: P10114
Chromosome Location: 13q34
Pathway: B Cell Receptor Signaling Pathway, organism-specific biosystem;
Function: GTP binding; GTPase activity; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.