Recombinant Human RASA1

Cat.No. : RASA1-28975TH
Product Overview : Recombinant fragment of Human GAP with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The protein encoded by this gene is located in the cytoplasm and is part of the GAP1 family of GTPase-activating proteins. The gene product stimulates the GTPase activity of normal RAS p21 but not its oncogenic counterpart. Acting as a suppressor of RAS function, the protein enhances the weak intrinsic GTPase activity of RAS proteins resulting in the inactive GDP-bound form of RAS, thereby allowing control of cellular proliferation and differentiation. Mutations leading to changes in the binding sites of either protein are associated with basal cell carcinomas. Alternative splicing results in two isoforms where the shorter isoform, lacking the N-terminal hydrophobic region but retaining the same activity, appears to be abundantly expressed in placental but not adult tissues.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : In placental villi, detected only in the trophoblast layer (cytotrophoblast and syncytiotrophoblast). Not detected in stromal, endothelial or Hofbauer cells (at protein level).
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : AKEPYMEGVNPFIKSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELLQQKQNQYTKTNDVR
Sequence Similarities : Contains 1 C2 domain.Contains 1 PH domain.Contains 1 Ras-GAP domain.Contains 2 SH2 domains.Contains 1 SH3 domain.
Gene Name RASA1 RAS p21 protein activator (GTPase activating protein) 1 [ Homo sapiens ]
Official Symbol RASA1
Synonyms RASA1; RAS p21 protein activator (GTPase activating protein) 1; RASA; ras GTPase-activating protein 1; capillary malformation arteriovenous malformation; CM AVM; GAP; p120GAP; p120RASGAP;
Gene ID 5921
mRNA Refseq NM_002890
Protein Refseq NP_002881
MIM 139150
Uniprot ID P20936
Chromosome Location 5q13
Pathway Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; Aurora A signaling, organism-specific biosystem; Aurora B signaling, organism-specific biosystem; Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem;
Function GTPase binding; Ras GTPase activator activity; glycoprotein binding; potassium channel inhibitor activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RASA1 Products

Required fields are marked with *

My Review for All RASA1 Products

Required fields are marked with *

0
cart-icon