Recombinant Human RASA1 Protein, His tagged
Cat.No. : | RASA1-001H |
Product Overview : | Recombinant Human RASA1 Protein (181-272 aa) with C-His tag was expressed in Baculovirus-Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect cells |
Tag : | His |
Protein Length : | 181-272 aa |
Description : | The protein encoded by this gene is located in the cytoplasm and is part of the GAP1 family of GTPase-activating proteins. The gene product stimulates the GTPase activity of normal RAS p21 but not its oncogenic counterpart. Acting as a suppressor of RAS function, the protein enhances the weak intrinsic GTPase activity of RAS proteins resulting in the inactive GDP-bound form of RAS, thereby allowing control of cellular proliferation and differentiation. Mutations leading to changes in the binding sites of either protein are associated with basal cell carcinomas. Mutations also have been associated with hereditary capillary malformations (CM) with or without arteriovenous malformations (AVM) and Parkes Weber syndrome. Alternative splicing results in two isoforms where the shorter isoform, lacking the N-terminal hydrophobic region but retaining the same activity, appears to be abundantly expressed in placental but not adult tissues. |
Source : | Insect cells |
Species : | Human |
Tag : | C-His |
Molecular Weight : | 12 kDa |
AA Sequence : | MWYHGKLDRTIAEERLRQAGKSGSYLIRESDRRPGSFVLSFLSQMNVVNHFRIIAMCGDYYIGGRRFSSLSDLIGYYSHVSCLLKGEKLLYPVHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol, 5% Trehalose, 0.5% SKL |
Concentration : | 0.75 mg/mL by Bradford |
Gene Name | RASA1 RAS p21 protein activator (GTPase activating protein) 1 [ Homo sapiens (human) ] |
Official Symbol | RASA1 |
Synonyms | RASA1; RAS p21 protein activator (GTPase activating protein) 1; RASA; ras GTPase-activating protein 1; capillary malformation arteriovenous malformation; CM AVM; GAP; p120GAP; p120RASGAP; triphosphatase-activating protein; PKWS; CMAVM; CM-AVM; RASGAP; DKFZp434N071 |
Gene ID | 5921 |
mRNA Refseq | NM_002890 |
Protein Refseq | NP_002881 |
MIM | 139150 |
UniProt ID | P20936 |
◆ Recombinant Proteins | ||
RASA1-4589R | Recombinant Rat RASA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RASA1-3433H | Recombinant Human RASA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RASA1-2382H | Recombinant Human RASA1 protein, MYC/DDK-tagged | +Inquiry |
RASA1-1779HFL | Recombinant Full Length Human RASA1 protein, Flag-tagged | +Inquiry |
RASA1-4930R | Recombinant Rat RASA1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RASA1-2510HCL | Recombinant Human RASA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RASA1 Products
Required fields are marked with *
My Review for All RASA1 Products
Required fields are marked with *