"RASGRP2" Related Products

Recombinant Human RASGRP2, His-tagged

Cat.No.: RASGRP2-31042TH
Product Overview: Recombinant fragment, corresponding to amino acids 230-609 of Human RASGRP2 with an N terminal His tag. Observed mwt: 50 kDa ;
Description: The protein encoded by this gene is a brain-enriched nucleotide exchanged factor that contains an N-terminal GEF domain, 2 tandem repeats of EF-hand calcium-binding motifs, and a C-terminal diacylglycerol/phorbol ester-binding domain. This protein can activate small GTPases, including RAS and RAP1/RAS3. The nucleotide exchange activity of this protein can be stimulated by calcium and diacylglycerol. Three alternatively spliced transcript variants encoding the same protein have been found for this gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 124 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: VAEKLLQLQNFNTLMAVVGGLSHSSISRLKETHSHVSPET IKLWEGLTELVTATGNYGNYRRRLAACVGFRFPILGVH LKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSLRPPVQANPDLLSLLTVSLDQYQTEDELYQLSLQRE PRSKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLDQALV VEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSA FGDLDQNQDGCISREEMVSYFLRSSSVLGGRMGFVHNF QESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQ CKDRLSVECRRRAQSVSLEGSAPSPSPMHSHHHRAFSFSL PRPGRRGSRPPEIREEEVQTVEDGVFDIHL
Gene Name: RASGRP2 RAS guanyl releasing protein 2 (calcium and DAG-regulated) [ Homo sapiens ]
Official Symbol: RASGRP2
Synonyms: RASGRP2; RAS guanyl releasing protein 2 (calcium and DAG-regulated); RAS guanyl-releasing protein 2; CALDAG GEFI;
Gene ID: 10235
mRNA Refseq: NM_001098670
Protein Refseq: NP_001092140
MIM: 605577
Uniprot ID: Q7LDG7
Chromosome Location: 11q13
Pathway: Adaptive Immune System, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Effects of PIP2 hydrolysis, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem;
Function: calcium ion binding; calcium ion binding; diacylglycerol binding; guanyl-nucleotide exchange factor activity; lipid binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.