"RBM4" Related Products

Expand
Expand

Recombinant Human RBM4, His-tagged

Cat.No.: RBM4-31230TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-364 of Human RBM4 with N terminal His tag, 45kDa.
Description: This gene encodes a protein that contains 2 RRM type RNA binding motifs and a retroviral type zinc finger.RBM4 may play a role in alternative splice site selection during pre mRNA processing.It binds TNPO3, which mediates nuclear import of the protein. This interaction is disrupted by nuclear Ran bound to GTP. RBM4 is ubiquitously expressed. It is expressed in fetal brain and is down regulated in fetal Down syndrome brain.
Source: E. coli
Species: Human
Tag: His
Form: Lyophilised. 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5.
AA Sequence: MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVE ASKNKSKTSTKLHVGNISPTCTNKELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIR GLDNTEFQGKRMHVQLSTSRLRTAPGMGDQSGCYRCGKEGHWSKECPIDRSGRVADLTEQY NEQYGAVRTPYTMSYGDSLYYNNAYGALDAYYKRCRAARSYEAVAAAAASVYNYAEQTLSQ LPQVQNTAMASHLTSTSLDPYDRHLLPTSGAAATAAAAAAA AAA VTAASTSYYGRDRSPLRRATAPVPTVGEGYGYGHESELSQASAAA RNSLYDMARYEREQ YADRARYSAF
Applications: SDS-PAGE; Mass Spectrometry
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
Reconstitution: Reconstitute with 84 µl aqua dest.
Gene Name: RBM4 RNA binding motif protein 4 [ Homo sapiens (human) ]
Official Symbol: RBM4
Synonyms: RBM4; LARK; RBM4A; ZCRB3A; ZCCHC21; RP11-658F2.8; RNA binding motif protein 4; RNA-binding protein 4; lark homolog; RNA-binding motif protein 4a; transcriptional coactivator CoAZ; zinc finger CCHC-type and RNA binding motif 3A
Gene ID: 5936
mRNA Refseq: NM_001198843
Protein Refseq: NP_001185772
MIM: 602571
UniProt ID: Q9BWF3
Chromosome Location: 11q13
Function: RNA binding; mRNA 3'-UTR binding; nucleotide binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.